KEGG   Streptococcus suis 98HAH33: SSU98_1567Help
Entry
SSU98_1567        CDS       T00515                                 

Definition
Alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ssv  Streptococcus suis 98HAH33
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:ssv00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SSU98_1567
  Lipid metabolism
   00561 Glycerolipid metabolism
    SSU98_1567
   00600 Sphingolipid metabolism
    SSU98_1567
Enzymes [BR:ssv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SSU98_1567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1487431..1489605)
Genome map
AA seq 724 aa AA seqDB search
MNVIEIYNEKQIFHLKTREFSYIIQVLETGDLVHRYFGKKIEKFSDGNKITYLDRSFSPS
PITGDRTYSLDVLPLEYSSNGLGDFRTSALDVRNEFGVTLDLKYKEYRLYKGKKELRGLP
ASFGNQEEVESLEIDLYDQLTDITVTLQYSVFEEASYLARSATIQTGKYPCKLEKVLSAT
LDFPHQDFIVHSLAGRYAYEKEWTQTPLTKGQYSIGSIRGASSHSRTPFLALVSPDASED
KGDVYAAHLVYSGNFTAFVETTAMETSRLGLGLESHYFSWQLDKDDRFQTPEVLLSYTDK
GFTGMTQNSHHFITKHLIRSSFVNKPRPILINNWEATYFEFTEEKILQLAQVASRAGIEL
FVLDDGWFGKRNNDESSLGDWKVNLDKLPNGLNGLAERINELGMKFGLWFEPEMISIDSD
LYREHPDWAIRTEGRLPIYSREQLVLDLTKQEVCDYIIDSVSSILESANISYVKWDMNRN
ITNIPEGLANDQRFEFHHRYMLGLYRVLDHLTKRFPDILFESCAGGGGRNDLGIMYYMPQ
AWASDDTDAIERLSIQEGTSLIYPPSSIGAHVSAVPNHQVGRITPLATRGNVAMMGGAFG
YELDLTKLSEKELDEISQQIETYHSIRETIQFGQLYRLKKTSNTWAANYVSQDKNQVVFT
FVKILAKPEAPLLHVRLKGLDPDALYECPQLGETFYGDELMNIGLTMPHVQKDYFSVQYI
FNKI
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgattgagatttataatgaaaaacagatttttcacctgaaaacaagagaattc
tcttatatcatccaagtattggaaacaggcgatctggttcatcgttattttgggaaaaaa
atcgaaaaatttagcgatggaaacaaaataacatatttagatcgatcgttttctccgagt
ccaattactggggataggacatactcattggatgtcctcccactcgaatattccagcaat
ggtctgggagattttagaacctcagcattagatgttcggaatgaatttggagtcactctt
gacctaaaatacaaagagtatcgattatacaaggggaaaaaagaactgaggggattacca
gcaagttttggaaatcaagaagaggtagagagtcttgaaattgatctttacgatcagttg
acagatattaccgtaactcttcagtattctgtttttgaagaagcttcctatctcgcacgg
tcagctacaattcaaactggcaaatatccatgcaaactagagaaggtcttgtctgcaacg
cttgattttccacatcaggatttcattgttcacagcttggcaggacgttatgcttatgaa
aaagagtggacacagaccccattgacaaaaggtcagtattcgattggtagcattcgaggt
gcttcaagtcactcaagaacaccctttttagcactagtttcacccgatgcaagtgaggac
aagggcgatgtttatgcagcccaccttgtttatagcggcaactttacagcatttgtcgaa
acgacagccatggaaaccagtcgtttgggactaggattggaaagtcactatttctcatgg
caattggataaggatgaccggtttcaaactccagaagttctcttatcatatactgataaa
ggatttactggcatgacacaaaatagtcatcactttatcacaaaacacctcattcgatca
tcgtttgtaaacaaaccaagacccattttaatcaacaactgggaagcgacctattttgaa
tttacagaagaaaagattttacagttagctcaggttgcaagtcgagctggtattgaattg
tttgttctggatgatggttggtttggtaaacgaaacaatgatgaaagttcattgggcgat
tggaaagtcaatttggataagttgccaaatggtttgaatggtttagcagagcgaataaat
gagcttggtatgaaattcggattgtggtttgaaccagagatgatttctattgatagcgat
ctttatcgtgagcatcctgattgggcaattcggacagaaggacgcttaccaatctacagc
cgagaacaattagttttggatttgaccaagcaggaagtctgtgactacatcattgatagc
gtctcttccatattagaatcagccaatatttcttatgtaaaatgggatatgaaccgtaat
atcaccaatattcctgaaggtttagcaaatgaccagcgctttgagttccaccatcgttac
atgctaggtctctaccgtgtattagaccaccttacaaagcggttcccggatattcttttc
gaatcctgtgcaggcggtggaggtcgtaatgatttgggaatcatgtattatatgccgcaa
gcttgggcaagtgatgatacagatgcgattgagcgcttatctattcaagaaggtactagt
ttgatttatcccccttcctcaattggtgcacacgtttctgccgttccaaaccatcaggtt
ggtcggatcacacctcttgctacacgaggcaatgtggctatgatgggaggagcatttggt
tacgagctggatttaacgaaactttcggaaaaggaattggatgaaatcagtcagcaaatc
gaaacctatcactccattcgtgaaactatacaattcggtcagctctaccgtctgaaaaag
acgagcaatacctgggctgccaattatgttagtcaagataagaatcaagtggtctttaca
tttgtaaaaattcttgccaagccagaagcgcctttgcttcatgttcggttgaaggggtta
gacccagatgccttgtatgaatgcccacaattaggagagacattctacggggatgaactg
atgaacattggtcttacaatgccacatgttcaaaaagattattttagtgtacaatatatt
tttaacaaaatctag

DBGET integrated database retrieval system