KEGG   Streptococcus suis 98HAH33: SSU98_1650Help
Entry
SSU98_1650        CDS       T00515                                 

Definition
(GenBank) Phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ssv  Streptococcus suis 98HAH33
Pathway
ssv00010  Glycolysis / Gluconeogenesis
ssv00260  Glycine, serine and threonine metabolism
ssv00680  Methane metabolism
ssv01100  Metabolic pathways
ssv01110  Biosynthesis of secondary metabolites
ssv01120  Microbial metabolism in diverse environments
ssv01130  Biosynthesis of antibiotics
ssv01200  Carbon metabolism
ssv01230  Biosynthesis of amino acids
Module
ssv_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ssv_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ssv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSU98_1650
  Energy metabolism
   00680 Methane metabolism
    SSU98_1650
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSU98_1650
Enzymes [BR:ssv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SSU98_1650
Membrane trafficking [BR:ssv04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SSU98_1650
Exosome [BR:ssv04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SSU98_1650
  Exosomal proteins of melanoma cells
   SSU98_1650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Imm70
Motif
Other DBs
NCBI-ProteinID: ABP92808
UniProt: A4W369
Position
complement(1552800..1553492)
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLKR
AIKTTNLALEAADQLWVPVEKSWRLNERHYGGLTGLNKAEAAAEFGDEQVHIWRRSYDTL
PPEMAKDHEHSAHTDRRYAHLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKQLSDDEIMDVEIPNFPPLVFELDENLNIVKEYYLEA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggtttttgctcgccatggtgagtctgaatggaacaaagctaaccttttc
actggttgggctgatgttgatttgtctgaaaaaggtacacaacaagcaatcgatgcaggt
aaattgatcaaagaagcaggtatcgaatttgaccttgctttcacatctgtattgaaacgt
gctatcaagactacaaacttggctcttgaagctgcagatcaattgtgggtaccagttgaa
aaatcgtggcgtttgaacgaacgtcactacggtggtttgactggcttgaacaaagctgaa
gcagctgctgaatttggtgatgagcaagttcacatctggcgtcgttcttatgatactttg
ccaccagaaatggctaaagatcatgagcattcagcacacactgaccgtcgctatgcacac
cttgatgattcagttattccagatgcagaaaacttgaaagtaacgcttgagcgtgccctt
ccattctgggaagataaaattgctccagcattgaaagacggtaaaaacgtattcgtgggt
gcacacggtaactcaatccgtgcccttgtaaaacacatcaaacaattgtctgatgacgaa
atcatggatgtggaaattccaaacttcccaccacttgtattcgaattggatgaaaacttg
aacattgtgaaagagtactacttggaagcataa

DBGET integrated database retrieval system