KEGG   Streptococcus suis 98HAH33: SSU98_1781Help
Entry
SSU98_1781        CDS       T00515                                 

Definition
acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase-like protein
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ssv  Streptococcus suis 98HAH33
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SSU98_1781
  Amino acid metabolism
   00300 Lysine biosynthesis
    SSU98_1781
Enzymes [BR:ssv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SSU98_1781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1669615..1670982)
Genome map
AA seq 455 aa AA seqDB search
MADSKVQAFENDAIIQTYFEKLKVLISKKSIFAQQIGLLDVATYLKDIFEEAGAEVVLDD
SYAAPFVMARFEASVPDAKTLIFYNHYDTVPADADQVWEKGNPFELTISDGYIYGRGVDD
DKGHITARLSALKKYQARQNGHLPVNVIFIMEGAEESASVDLDKYLSKYKEHLIGADLLV
WEQGHRNSLHQLEIAGGNKGIVTFDLQVKSADLDIHSSYGGVIDSASWYLLSALQSMRAA
DGQILVEGIYDQVQEPNERELALVEEFALATSQSMTDIYGLTLPTLIEDRREFLKRLYFE
PSITIQGLSTGYLGQGVKTIIPAQASAKMEVRLVPGLEPHDVLDKIRQHLDKHGFDKVEV
VFTLGEMSYRSDMSHPAIVNVIELAKKLTPEGVAVLPTSPGTGPMHTVFHALGVPIAGFG
LGNANSRDHAGDENVSIADYYSHVELVEELIASYE
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcagatagtaaagttcaagcatttgaaaatgatgcgattattcaaacctattttgaa
aagttgaaggtcttgatttcaaagaaatccatttttgctcagcagattggtttgctggat
gtggcgacttacttgaaagatatatttgaagaagctggtgcagaggttgttttggatgat
agttatgcagcaccctttgtcatggctaggtttgaggcttcggttccagatgcgaaaaca
ttgattttctacaatcattatgatacagtacctgcagatgccgatcaggtctgggagaag
ggcaaccccttcgaattgaccatttccgatggctatatctatggtcgcggggtagatgat
gataagggccatatcacagctcgtctgtcggccttgaaaaaatatcaagctagacagaat
ggccatttaccagtcaatgtgatttttattatggaaggggcagaagagtcagcctctgtc
gacttggataagtatctttcaaaatataaagaacatttgattggtgctgatttgcttgtc
tgggagcaggggcatcgcaatagcctacatcagctagaaattgctggtgggaataaggga
attgtgaccttcgatcttcaggtcaaatcagctgacttggatattcattcttcctatggt
ggtgtcattgattcggcaagctggtatttattatcagcacttcaatccatgcgggctgca
gatgggcaaattctggtagaaggcatttacgatcaggttcaagagccaaatgagcgtgaa
ttggccttggtggaagaatttgcactggctaccagtcagtctatgacggatatttatgga
ctaacccttccaaccttgatagaagatcgtcgtgagtttctgaagcgtttgtattttgaa
ccatcgattaccattcaaggcttgtcaactggctatcttggtcaaggtgtcaagaccatc
ataccagctcaggcttctgctaagatggaagtccgtctggtacctggattggagccgcat
gatgtattagataagattcgccagcatttggataaacatggttttgacaaagttgaggtt
gtcttcactctaggagagatgagctaccgaagtgacatgtcccaccctgccattgtcaat
gtgattgagttggctaaaaagttgacgccagaaggagttgctgttttgccgacgtcaccg
gggacaggacccatgcatacagtttttcatgccttgggcgtgccgattgcaggatttgga
ttaggaaatgccaacagtcgcgaccatgcaggtgatgaaaatgtcagcatcgctgactac
tatagccatgttgaattagtagaggagttaattgcaagttatgagtaa

DBGET integrated database retrieval system