KEGG   Streptococcus suis 98HAH33: SSU98_2027Help
Entry
SSU98_2027        CDS       T00515                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
ssv  Streptococcus suis 98HAH33
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:ssv00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    SSU98_2027 (gltX)
Enzymes [BR:ssv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     SSU98_2027 (gltX)
Amino acid related enzymes [BR:ssv01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   SSU98_2027 (gltX)
Transfer RNA biogenesis [BR:ssv03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SSU98_2027 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1928681..1930186)
Genome map
AA seq 501 aa AA seqDB search
MHIYAIMFLIEILQERNMTKPIRVRYAPSPTGLLHIGNARTALFNYLFARHHGGTFLIRI
EDTDRKRHVEDGERSQLENLRWLGIDWDESPETHENYRQSERLDIYQKYVDQLLAEGKAY
KSYVTEEELAAERERQEAAGETPRYINEYLGMSEDEKTAYIAEREAAGIVPTVRLAVNEA
GIYKWNDIVKGEIEFEGGNIGGDWVIQKRDGYPTYNFAVVIDDYLMKISHVIRGDDHIAN
TPKQLMVYEALGWEAPEFGHMTLIINSETGKKLSKRDTNTLQFIEDYRRKGYMPEAVFNF
IGLLGWNPGGEEEIFSREQFIQLFDENRLSKSPAAFDQKKMDWMSNEYIKNADLETIFNL
AKPFLEEAGRLTDKAEKLVELYKPQMSSADEIVGLTDLFFSDFPELTAEEKEVMAGETVP
TVLNALKEKLEAMTDEDFQPDNIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPN
TIYLLGREKSIQHIDNMLKSL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgcatatctatgctataatgttcttgattgaaattttacaggagagaaacatgactaaa
ccaattcgtgtgcgttacgcaccaagtccaacgggacttttgcatatcggaaatgcccgt
acagcattgtttaactatctttttgcccgtcatcatggcggtactttcctcattcgtatc
gaggatacagaccgcaagcgccatgtggaagacggcgagcgttctcaacttgaaaacctg
cgttggttgggtattgactgggatgagagtccagaaacccatgagaactaccgtcagtct
gagcgtttggatatttaccaaaagtatgttgatcagctcttggcagaaggcaaggcctac
aagtcttatgtgaccgaagaagagttggcggcggagcgtgagcgtcaggaagctgcgggc
gaaacacctcgctacatcaacgaataccttggtatgtctgaggatgaaaaaactgcctac
atcgcagagcgtgaggcggctggcattgtcccaacggtccgcttggctgtcaacgaagct
ggtatctacaagtggaacgacatagttaagggtgagatcgagtttgaaggtggcaacatc
ggtggtgactgggttatccagaaacgtgacggctacccaacctacaactttgccgtggtc
attgatgattatctcatgaaaatctcgcacgttatccgtggggatgaccacattgccaac
acacccaagcagctcatggtctatgaagcacttggttgggaagcgccagaatttggtcac
atgacgcttattatcaattctgaaacaggtaaaaagttgtctaaacgtgatactaacacc
cttcagttcatcgaagattaccgccgtaaaggttacatgcctgaggctgtcttcaacttt
atcggtcttttgggttggaacccgggtggtgaagaggaaatcttctctcgtgagcaattt
atccaactcttcgatgagaaccgtctcagcaagtcacccgctgcctttgaccagaagaaa
atggactggatgagcaatgagtacatcaaaaatgctgatttagaaactattttcaacctt
gctaagccattcttggaagaagcggggcgtttgacagacaaggcagaaaaattggtggaa
ctttacaagccacagatgtcatctgcggatgaaatcgttggtttgacagaccttttcttc
tctgatttcccagaattgactgcggaagaaaaagaagtcatggcaggcgaaacggttcca
actgttctcaacgccctcaaggaaaaattggaagccatgacggacgaagatttccaacca
gataacatcttcccacaaatcaaggctgttcaaaaagaaacaggcatcaagggcaaaaac
ctcttcatgccaatccgtatcgctgtttcaggcgaaatgcatggacctgagttgccaaat
actatttacctgctcggccgtgaaaaatccatccagcatattgacaatatgttgaagagt
ttgtaa

DBGET integrated database retrieval system