KEGG   Streptococcus suis GZ1: SSGZ1_0255Help
Entry
SSGZ1_0255        CDS       T02023                                 

Definition
Zinc-containing alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ssw  Streptococcus suis GZ1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssw00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SSGZ1_0255
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSGZ1_0255
  Lipid metabolism
   00071 Fatty acid degradation
    SSGZ1_0255
  Amino acid metabolism
   00350 Tyrosine metabolism
    SSGZ1_0255
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SSGZ1_0255
   00626 Naphthalene degradation
    SSGZ1_0255
Enzymes [BR:ssw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SSGZ1_0255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(266930..267955)
Genome map
AA seq 341 aa AA seqDB search
MKAVVVNPESTGVVVVEKELRPLEAGEALVQIEYCGVCHTDLHVANGDFGKVPGRVLGHE
GIGIVTEIAPGVTSLKVGDRVSVAWFFQGCGMCEYCTTGRETLCRTVKNAGYSVDGGMAE
QCIVTADYAVKVPEGLDPAQASSITCAGVTCYKAIKEAHLEPGQWIAIYGAGGLGNLAVQ
YAKKVFNAHVIAVDINNDKLELAKEVGADVTINGLEVEDVPGYIKEITGGGVHSTVVTAV
SKVAFNQAIDSVRAGGYVVAVGLPSEYMDLSIVKTVLDGIKVVGSLVGTRKDLEEAFHFG
AMGLVVPVVQKRPVEDAEAVFNEMVAGTIQGRMVLDFCHSH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtcgttgtaaatccagaatctactggtgttgtcgttgtcgaaaaggaactt
cgtccactcgaagctggtgaggctttggtccaaattgagtactgtggtgtttgtcacact
gacctccacgttgccaatggtgattttggtaaggttcctggtcgcgttcttggtcacgaa
ggaatcggtattgttacagaaatcgcacctggtgttaccagtctaaaagttggtgaccgt
gtcagcgttgcttggttcttccaaggctgtggtatgtgtgaatattgtacaaccggtcgc
gaaactctctgccgtaccgtaaaaaatgcaggctactctgttgacggtggtatggctgag
caatgtattgtaacagcggactatgcagtaaaagttccagaaggtcttgatccagctcaa
gcaagttctatcacttgtgctggcgttacttgctacaaagcgattaaagaagctcacttg
gaaccaggtcaatggattgctatctatggtgctggtggacttggaaaccttgctgtacaa
tacgctaaaaaagtcttcaacgctcatgttatcgccgtagacatcaataatgataaattg
gaactcgccaaagaagttggtgcagatgtgacgatcaacggacttgaagtagaagatgtt
cctggatatattaaagaaattactggtggcggtgtacactctactgttgtaacagctgtt
tccaaagtagccttcaaccaagctattgacagtgttcgtgctggtggatatgtagtagct
gtcggacttccatctgaatacatggacctcagtatcgtgaagactgtgctagacggtatc
aaagtggtcggctcactagttggtactcgtaaagatttagaagaggccttccacttcggt
gctatgggactagttgttccagtcgttcaaaaacgccctgtcgaagatgccgaagcagtc
ttcaatgaaatggttgccggtactatccaaggtcgtatggtcttagacttctgccactca
cactaa

DBGET integrated database retrieval system