KEGG   Streptococcus suis GZ1: SSGZ1_0258Help
Entry
SSGZ1_0258        CDS       T02023                                 

Definition
Threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ssw  Streptococcus suis GZ1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ssw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SSGZ1_0258
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSGZ1_0258
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SSGZ1_0258
Enzymes [BR:ssw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SSGZ1_0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
271461..272957
Genome map
AA seq 498 aa AA seqDB search
MRDTMTLVYQSTRDAKNTVSASQAILQGLATDGGLFTPLSIPTVDLDFSVLKDASYQDVA
KLILSAFLDDFTADELDYCINNAYDSKFDTSVIAPVVKLKGQYNLELFRGSTIAFKDMAL
SILPYLMATATKKHGLENEIVILTATSGDTGKAAMAGFADVPGTQIIVFYPRDGVSKVQE
LQMTTQTGANTHVVAIDGNFDDAQTNVKHMFNDEALRAKLAAKKLQFSSANSMNIGRLVP
QIVYYVYAYAQLVKTGEIAAGDKVNFTVPTGNFGNILAAYYAKQIGLPVGKLICASNDNN
VLTDFFATGVYDKNRTFRVTTSPSMDILVSSNLERLIFHLFGNDAAKTAELMEALNTAGQ
YDIQGADAEILSLFAAAFATEEETAAEIKRVYDESDYIEDPHTAVASAVYKQYVEQTGDQ
TPTVIASTASPYKFPVVAVEAVTGQSGLSDFEALAKLHEISGVDLPPAVDGLETAPVRHN
TVVAAADMQTEVERYLGV
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagggataccatgacattagtatatcaatcaacacgcgatgctaaaaatactgtatcg
gctagtcaagcgattttgcagggcttggcgaccgacggtggtttgtttacaccgctttct
attccaacagttgacttggatttttctgttttgaaagatgcttcttatcaagacgttgcc
aagctgattttgtcggctttcttggatgattttacggcagatgagttggactactgtatc
aataacgcctacgacagtaagtttgacacgtcagttattgccccagtggttaagctaaaa
ggtcagtacaacttggagctcttccgtggctcaaccattgccttcaaggatatggctctg
tccatcctcccttacttgatggcgacggcgactaaaaagcacggtttggaaaacgaaatt
gtcatcctgaccgcgacttcaggcgatacaggcaaggcagccatggctggttttgcggac
gttcctggcacacaaatcattgtcttctatccgcgtgacggggtatctaaggtccaagaa
ttgcagatgaccacgcagacaggggctaatacccacgtggtggctattgacggtaacttc
gacgatgcccagaccaatgtcaaacacatgttcaacgatgaggcactccgtgccaagttg
gcggctaagaaactccagttttcatctgccaactctatgaacatcggccgcttggtgcca
cagattgtttactatgtctatgcctacgctcagctggttaagactggtgagattgcggcg
ggcgacaaggtcaacttcaccgttccaacaggaaactttggaaacatcttggcagcttat
tacgccaaacaaatcggtctgccagttggcaagctcatctgtgcgtccaacgacaacaat
gtcctaaccgacttcttcgcgacaggcgtttacgataagaaccgtaccttccgcgtgacc
accagtccgtccatggacatcttggtgtcttctaacttggagcgcttgattttccatctc
tttggcaatgacgctgcaaaaacagctgagctgatggaagccttgaacacagctggtcag
tatgacattcaaggggctgacgcggaaatcctctcgctctttgctgccgcctttgcgacg
gaagaagaaaccgctgcggaaatcaagcgtgtctatgacgagtcagactacattgaagat
ccacatacggctgttgcctcagctgtctataaacagtatgtggagcaaacaggggaccaa
actccgacagtgattgcttctacagcaagtccttacaagttccctgtggttgcggtagag
gcggtgacaggccagtcaggtttgtctgactttgaagcccttgcaaaattgcatgagatt
tcaggtgtagacttgccaccagctgtggacggcttggaaacggcacccgtccgccacaat
accgtcgttgcagctgccgatatgcagactgaagtagaacgctatttgggtgtttaa

DBGET integrated database retrieval system