KEGG   Streptococcus suis GZ1: SSGZ1_0375Help
Entry
SSGZ1_0375        CDS       T02023                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ssw  Streptococcus suis GZ1
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ssw00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
404569..405219
Genome map
AA seq 216 aa AA seqDB search
MKDLKGDIMKERGLLIVFSGPSGVGKGTVRKEIFESSDNKFEYSVSMTTRPQRPGEVDGV
DYFFRSREEFEDLIRQGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQGALQVK
KKVPDGVFIFLTPPDLEELQDRLIGRGTDSEEVIAQRIERAKEEIALMREYDYAVVNDEV
PLAAERVKRIIEAEHFRVDRVIGRYDEMIREQIVER
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatttaaaaggagatatcatgaaagagcgaggcttactcattgtcttttctggt
ccatctggtgttggaaaaggaacagttcgaaaggaaatttttgaaagctctgataataaa
tttgaatattctgtatccatgacgacacgtccacagagaccgggagaagttgatggagtt
gactatttcttccgtagtcgtgaggaatttgaagatttgattcgccagggtcaaatgttg
gaatatgcagagtacgttggaaattactatggaacacctctgacctatgtcaatgaaact
cttgataagggaattgatgtctttttagaaattgaagtacagggtgccctccaagtgaag
aaaaaggttccagatggggtgttcattttcttgacaccacctgacttggaggagttgcaa
gatcgcttgattggtcgcggaacggatagtgaggaagttattgctcaacgtatcgaacgt
gccaaggaagagattgccttgatgcgtgagtatgattatgcagttgtgaacgatgaagtt
ccgttggctgctgagcgtgtcaagcgtataatcgaagcagaacatttccgtgtagaccga
gtgattggtcgctacgatgaaatgattcgtgaacagatagtagaacgataa

DBGET integrated database retrieval system