KEGG   Streptococcus suis GZ1: SSGZ1_0375Help
Entry
SSGZ1_0375        CDS       T02023                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ssw  Streptococcus suis GZ1
Pathway
ssw00230  Purine metabolism
ssw01100  Metabolic pathways
Module
ssw_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ssw00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SSGZ1_0375
Enzymes [BR:ssw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SSGZ1_0375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_22 RsgA_GTPase NB-ARC
Motif
Other DBs
NCBI-ProteinID: ADE30840
UniProt: D5AG75
Position
404569..405219
Genome map
AA seq 216 aa AA seqDB search
MKDLKGDIMKERGLLIVFSGPSGVGKGTVRKEIFESSDNKFEYSVSMTTRPQRPGEVDGV
DYFFRSREEFEDLIRQGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQGALQVK
KKVPDGVFIFLTPPDLEELQDRLIGRGTDSEEVIAQRIERAKEEIALMREYDYAVVNDEV
PLAAERVKRIIEAEHFRVDRVIGRYDEMIREQIVER
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatttaaaaggagatatcatgaaagagcgaggcttactcattgtcttttctggt
ccatctggtgttggaaaaggaacagttcgaaaggaaatttttgaaagctctgataataaa
tttgaatattctgtatccatgacgacacgtccacagagaccgggagaagttgatggagtt
gactatttcttccgtagtcgtgaggaatttgaagatttgattcgccagggtcaaatgttg
gaatatgcagagtacgttggaaattactatggaacacctctgacctatgtcaatgaaact
cttgataagggaattgatgtctttttagaaattgaagtacagggtgccctccaagtgaag
aaaaaggttccagatggggtgttcattttcttgacaccacctgacttggaggagttgcaa
gatcgcttgattggtcgcggaacggatagtgaggaagttattgctcaacgtatcgaacgt
gccaaggaagagattgccttgatgcgtgagtatgattatgcagttgtgaacgatgaagtt
ccgttggctgctgagcgtgtcaagcgtataatcgaagcagaacatttccgtgtagaccga
gtgattggtcgctacgatgaaatgattcgtgaacagatagtagaacgataa

DBGET integrated database retrieval system