KEGG   Streptococcus suis GZ1: SSGZ1_0522Help
Entry
SSGZ1_0522        CDS       T02023                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ssw  Streptococcus suis GZ1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ssw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSGZ1_0522
   01230 Biosynthesis of amino acids
    SSGZ1_0522
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSGZ1_0522
   00051 Fructose and mannose metabolism
    SSGZ1_0522
   00562 Inositol phosphate metabolism
    SSGZ1_0522
Enzymes [BR:ssw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SSGZ1_0522
Exosome [BR:ssw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SSGZ1_0522
  Exosomal proteins of bladder cancer cells
   SSGZ1_0522
  Exosomal proteins of melanoma cells
   SSGZ1_0522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
563797..564549
Genome map
AA seq 250 aa AA seqDB search
MSRKPIIAGNWKMNKNPQEAQAFVEAIAGKLPAGDKIEAAIAAPAVDLNALLWFAKDSEL
KVAAQNCYFEDAGAFTGETSPKVLAEMGVNYVVIGHSERRDYFYETDEDINKKAHAIFRN
GLTPIICCGESLETYEAGKAVEFVGAQVSAALKDLTAEQVASLVIAYEPIWAIGTGKSAT
KDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVNPSNVAEYMACPDVDGALVGGASLE
AESFLALLNF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaatcattgccggtaactggaaaatgaacaaaaatcctcaagaagca
caagcattcgttgaggctattgcaggaaaattgcctgcaggcgacaaaattgaagcagct
atcgcagcaccagctgtagatttgaatgctttgttgtggttcgctaaagattctgaattg
aaagttgctgctcaaaactgctactttgaagatgctggtgccttcactggtgaaacatct
ccaaaagtattggctgaaatgggtgttaactatgttgttatcggtcactcagagcgtcgt
gattacttctacgaaactgatgaagatattaataaaaaagctcatgcaatcttccgtaac
ggtttgactccaatcatctgttgtggtgagtcacttgaaacttacgaagctggtaaagcg
gttgaattcgtaggtgctcaagtttctgcagctttgaaagacttgactgctgaacaagta
gcatcacttgttattgcttacgagccaatctgggcaatcggtactggtaaatcagctact
aaagatgatgcacaaaacatgtgtaaagctgttcgggacgttgttgctgctgatttcggt
caagaagttgcagacaaagttcgcgttcaatacggtggttctgtaaacccatcaaacgtt
gctgaatacatggcatgtccagacgttgacggtgcgcttgttggtggtgcatcacttgaa
gcagaaagcttcttggctttgttgaacttctaa

DBGET integrated database retrieval system