KEGG   Streptococcus suis GZ1: SSGZ1_0636Help
Entry
SSGZ1_0636        CDS       T02023                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ssw  Streptococcus suis GZ1
Pathway
ssw00480  Glutathione metabolism
ssw00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ssw00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SSGZ1_0636
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SSGZ1_0636
Enzymes [BR:ssw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SSGZ1_0636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ADE31095
UniProt: D5AGY0
Position
678960..679487
Genome map
AA seq 175 aa AA seqDB search
MKWNIYSLILTRGGYIMSIYDFTVQKQDGTDQSMAEYQGQVLLIVNTAPGCGLAPQYKEL
QELYDSYKDNGFVVLDFPCNQFLNQAPGSAEDINQICSLNYGTTFPRFAKIAVNGSEASP
LYRYLKKEKSTLLGGRIEWNFTKFLVDRQGRVVKRYLPTTSPLKLKEDIELYLEK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggaacatttattcacttattttgactagaggaggatatataatgagcatttat
gattttacagtacaaaaacaagatggcacagaccagtccatggctgagtatcaaggacaa
gttttacttatagtcaatacagcgccaggttgtggattggcaccacaatacaaggaacta
caggagctatatgatagctataaagacaacggttttgtagtgttggatttcccttgtaat
caatttttaaatcaggctcccggttctgcggaagacatcaatcagatctgtagcttgaat
tatggtacaacttttcctcgttttgctaaaattgctgtgaatggatctgaagctagtccg
ctatatcgctatcttaagaaagaaaaatcaaccttattaggaggtcgaattgagtggaat
tttaccaagtttttggtggatagacaagggcgtgtggtcaaacgatatttaccaacaact
agtccattaaaacttaaagaggatattgaactttacctagaaaaataa

DBGET integrated database retrieval system