KEGG   Streptococcus suis GZ1: SSGZ1_0774Help
Entry
SSGZ1_0774        CDS       T02023                                 

Definition
(GenBank) Aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ssw  Streptococcus suis GZ1
Pathway
ssw00240  Pyrimidine metabolism
ssw00250  Alanine, aspartate and glutamate metabolism
ssw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssw00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SSGZ1_0774
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SSGZ1_0774
Enzymes [BR:ssw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SSGZ1_0774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ADE31231
UniProt: D5AHB6
Position
818558..819481
Genome map
AA seq 307 aa AA seqDB search
MTITNGKVSLKHLVTMETLSNEEVLGLIQRGIAFKRGEKVELDRKYYASNLFFEDSTRTH
KSFEMAELRLDMGMIDFDARTSSVNKGETLCDTILTMSALGVDICVIRHSEVDYYKQLID
SPTIQTSIVNGGDGSGQHPSQSLLDLMTIYEEFGTFDGLKIAIAGDITHSRVAKSNMQIL
KRLGAEIFFAGPEEWYAEEFDVYGQHLNIDDIVETVDVLMLLRVQHERHDGDGGFSKETY
NRLHGLTEERYKRLKDTAIVMHPAPVNRDVEIDDSLVEAPKSRIVRQMQNGVFVRMAILE
AIVNGKA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacaattacaaatggtaaagtttcactcaaacacttggttacaatggagaccctctca
aatgaagaagtattgggactcattcaacgtggtattgcttttaaacgcggtgaaaaggta
gagttagatcggaagtactatgcttctaaccttttctttgaggattcaactcggacgcat
aagtcttttgaaatggcagagcttcgtttggatatgggaatgattgactttgatgctcgt
accagctcagtcaataagggtgaaaccttgtgtgataccattttgaccatgtcggcactt
ggggtagacatctgcgtgattcgtcactcggaagtggattattacaagcaattgattgat
agtcctaccattcagacttcaattgtcaatggtggtgatggttcaggtcaacacccaagc
caatccctacttgatttgatgactatttatgaagaatttggaacttttgacggcttgaag
attgccattgcaggtgatattacacactcacgggttgctaagtccaatatgcaaattttg
aagcgtctgggagctgagattttctttgctggaccggaggaatggtacgcagaggaattt
gacgtctatggtcagcatttgaatattgatgatattgtggaaacggtagatgtactgatg
ttgctccgtgtgcaacacgagcgtcatgatggtgatggtggtttttctaaagaaacttat
aaccgtttgcatggtttaacagaggagcgctacaaacgcttgaaagatactgcaattgtt
atgcatcctgcccctgttaaccgcgatgttgagattgatgattctctagttgaagcaccc
aaatcacgtattgtccgtcaaatgcagaatggtgtatttgtccggatggcgattttggaa
gcaattgtcaatggcaaggcttaa

DBGET integrated database retrieval system