KEGG   Streptococcus suis GZ1: SSGZ1_0812Help
Entry
SSGZ1_0812        CDS       T02023                                 

Definition
(GenBank) Glucokinase ROK
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ssw  Streptococcus suis GZ1
Pathway
ssw00010  Glycolysis / Gluconeogenesis
ssw00052  Galactose metabolism
ssw00500  Starch and sucrose metabolism
ssw00520  Amino sugar and nucleotide sugar metabolism
ssw00521  Streptomycin biosynthesis
ssw01100  Metabolic pathways
ssw01110  Biosynthesis of secondary metabolites
ssw01120  Microbial metabolism in diverse environments
ssw01130  Biosynthesis of antibiotics
ssw01200  Carbon metabolism
Module
ssw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ssw_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSGZ1_0812
   00052 Galactose metabolism
    SSGZ1_0812
   00500 Starch and sucrose metabolism
    SSGZ1_0812
   00520 Amino sugar and nucleotide sugar metabolism
    SSGZ1_0812
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SSGZ1_0812
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SSGZ1_0812
Enzymes [BR:ssw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SSGZ1_0812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N M11L
Motif
Other DBs
NCBI-ProteinID: ADE31269
UniProt: D5AHF4
Position
861936..862934
Genome map
AA seq 332 aa AA seqDB search
MCYNKENTFEVMIMSKKIIGIDLGGTSVKLAILTTEGEIQEKWSIKTNILDDGSHIVPDI
IDSIKQRFETHGLTKDDFLGIGMGSPGVVDSEAGTVIGAYNLNWKTLQLVKEQFESALGL
PFFIDNDANVAALGEQWVGAGNNNPNVVFMTLGTGVGGGVIAAGNLIRGVKGAGGELGHI
TVDFDEPFACTCGKKGCLETVASATGIVNLSRRYADQYAGDAKLKQMIDDGQDVTAKDVF
DLAKEGDDLALIVYRHFSEYLGVACANIAAVLNPAYIVLGGGVSAAGEFLLDGVRKVFAE
NSFPQIKESTQIVLATRGNDAGVLGAASLVLK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
ttgtgttataataaagaaaatacatttgaggtgatgattatgtctaaaaaaattatcggt
attgaccttgggggaacttctgttaaattggccattttgactactgagggagaaattcaa
gaaaaatggtctatcaagacaaatattttagatgatggaagtcatattgttcctgatatt
attgacagtatcaagcagcgatttgaaacccatggtttgacaaaggacgatttcttagga
attggtatgggctcacccggtgtagtggatagtgaagctggcactgttatcggagcctat
aacctcaactggaagaccttgcaattggtcaaagagcagtttgaatctgcgctcggttta
ccattctttattgacaatgatgcaaacgtagcggccctcggtgaacaatgggttggtgct
ggaaacaacaatccaaacgttgtctttatgacgcttggtacaggtgtcggtggcggtgtc
atcgctgctggaaacttgattcgtggtgtcaaaggtgctggtggcgaattgggccatatc
acagttgactttgatgagccatttgcatgtacttgtggtaagaaaggttgtctagaaaca
gttgcttcagcgacaggtattgtcaacctcagccgtcgctatgctgatcaatacgcaggc
gatgcaaaactgaaacaaatgattgatgatgggcaagatgtaacggctaaagatgtcttt
gatttggcaaaagagggcgatgatttggctttgattgtctaccgtcacttctcagaatac
ttaggtgttgcttgtgcaaacattgctgcagtcctcaatcctgcctacatcgttcttggt
ggtggtgtatcagctgcgggagagttcttattggatggcgttcgcaaggtctttgctgaa
aatagcttcccacaaatcaaggaaagtacacaaattgtcttggcaacacgtggtaatgat
gcaggtgtattgggcgcagcatcactcgtcttgaaataa

DBGET integrated database retrieval system