KEGG   Streptococcus suis GZ1: SSGZ1_0812Help
Entry
SSGZ1_0812        CDS       T02023                                 

Definition
Glucokinase ROK
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ssw  Streptococcus suis GZ1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSGZ1_0812
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSGZ1_0812
   00052 Galactose metabolism
    SSGZ1_0812
   00500 Starch and sucrose metabolism
    SSGZ1_0812
   00520 Amino sugar and nucleotide sugar metabolism
    SSGZ1_0812
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SSGZ1_0812
   00524 Butirosin and neomycin biosynthesis
    SSGZ1_0812
Enzymes [BR:ssw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SSGZ1_0812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
861936..862934
Genome map
AA seq 332 aa AA seqDB search
MCYNKENTFEVMIMSKKIIGIDLGGTSVKLAILTTEGEIQEKWSIKTNILDDGSHIVPDI
IDSIKQRFETHGLTKDDFLGIGMGSPGVVDSEAGTVIGAYNLNWKTLQLVKEQFESALGL
PFFIDNDANVAALGEQWVGAGNNNPNVVFMTLGTGVGGGVIAAGNLIRGVKGAGGELGHI
TVDFDEPFACTCGKKGCLETVASATGIVNLSRRYADQYAGDAKLKQMIDDGQDVTAKDVF
DLAKEGDDLALIVYRHFSEYLGVACANIAAVLNPAYIVLGGGVSAAGEFLLDGVRKVFAE
NSFPQIKESTQIVLATRGNDAGVLGAASLVLK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
ttgtgttataataaagaaaatacatttgaggtgatgattatgtctaaaaaaattatcggt
attgaccttgggggaacttctgttaaattggccattttgactactgagggagaaattcaa
gaaaaatggtctatcaagacaaatattttagatgatggaagtcatattgttcctgatatt
attgacagtatcaagcagcgatttgaaacccatggtttgacaaaggacgatttcttagga
attggtatgggctcacccggtgtagtggatagtgaagctggcactgttatcggagcctat
aacctcaactggaagaccttgcaattggtcaaagagcagtttgaatctgcgctcggttta
ccattctttattgacaatgatgcaaacgtagcggccctcggtgaacaatgggttggtgct
ggaaacaacaatccaaacgttgtctttatgacgcttggtacaggtgtcggtggcggtgtc
atcgctgctggaaacttgattcgtggtgtcaaaggtgctggtggcgaattgggccatatc
acagttgactttgatgagccatttgcatgtacttgtggtaagaaaggttgtctagaaaca
gttgcttcagcgacaggtattgtcaacctcagccgtcgctatgctgatcaatacgcaggc
gatgcaaaactgaaacaaatgattgatgatgggcaagatgtaacggctaaagatgtcttt
gatttggcaaaagagggcgatgatttggctttgattgtctaccgtcacttctcagaatac
ttaggtgttgcttgtgcaaacattgctgcagtcctcaatcctgcctacatcgttcttggt
ggtggtgtatcagctgcgggagagttcttattggatggcgttcgcaaggtctttgctgaa
aatagcttcccacaaatcaaggaaagtacacaaattgtcttggcaacacgtggtaatgat
gcaggtgtattgggcgcagcatcactcgtcttgaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system