KEGG   Streptococcus suis GZ1: SSGZ1_0898Help
Entry
SSGZ1_0898        CDS       T02023                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ssw  Streptococcus suis GZ1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SSGZ1_0898
Enzymes [BR:ssw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SSGZ1_0898
Exosome [BR:ssw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSGZ1_0898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
940090..941940
Genome map
AA seq 616 aa AA seqDB search
MEIAMTEFTDLDLYYMNTGEHTTLYEKMGAHIIKERNKIIGTQFRVYAPNAREVFLVGNF
NEWQRSHSMEREIDGVFQLYVDGLKSLEDYKYLIITHDGREIYKADPYAFFSQVRPDTAS
TTYNSRYKFKDDIWMYNRVNYDFKEQPVSIYEVHLGSWKQKFANKNEGGAPVEAFNSYKE
ITPLLIEHIKENNYTHIELLPITEHPLDASWGYQVTGYYSPTSRYGKPDELKYLVDQCHQ
AGIGVILDWVPLHFCKDAHGLYQFDGSWLYEYSYEQDRENHQWGTANFDLGKGLTRSFLL
SNLKYWLEYFHFDGIRVDALSYLLYWRGETDEDKINHAAIDFIKRVNAMVHTDYKGVLMI
AEDSSSFPKVTHPLEDGGIGFDMKWDLGWMNDTLKFVERPAIYRKYHSNEITFGMYYNQN
EQFLLPLSHDEVVHGKHSIIEKMNGDYEDKFHLARVYYSFYFAHPGKKLLFMGNEWGHIR
EWHEYTEMDWGLLQFPIHHSFYQMMKTLSTFYKEHDAFWKYDYQAYEKGFNWVKIDEEAS
LYAFSRTSDVQEILTIHNFNDQELFDVHLDLPADSEYKLVFSSNAIPMDTFSLYPDENGA
RITVPRLTSFYLERVK
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggagattgctatgacagaatttactgacctagatttatattatatgaatactggtgag
cataccactctttacgaaaaaatgggtgctcatattataaaagaacgaaacaaaattatc
ggaacccaatttcgtgtctatgccccaaatgccagagaagtattcttagttggcaacttt
aacgagtggcaacgcagtcactctatggagcgtgaaattgatggagtatttcaactttat
gtagacggattaaaatcccttgaagattataaatacctgattatcacacacgatgggcgt
gaaatatataaggctgacccttatgcatttttcagccaagttcgtccagacactgcctct
acaacctacaattcgcgttataaattcaaagatgacatctggatgtataatcgtgttaac
tatgattttaaagaacagccagtatccatctacgaggtgcacttaggttcgtggaagcaa
aaatttgctaataaaaatgaaggaggagctcctgtagaagctttcaatagttataaggaa
attactccacttctcatcgaacatatcaaggaaaataactacacacatattgagttattg
ccaattaccgagcatcctctcgatgcgtcttggggctatcaggtaacaggctactacagt
ccaactagtcgctatggcaagccagatgaacttaagtatttagttgaccaatgtcaccaa
gcaggaatcggagtgattcttgactgggtaccacttcatttctgtaaagatgctcatggg
ctctaccagtttgatggtagttggctatacgaatactcctacgaacaagaccgtgaaaat
caccagtgggggactgctaattttgaccttggaaaaggactgactcgttctttccttctt
tctaatttaaaatactggttggaatatttccattttgatggcatccgtgttgatgcacta
tcttatctcctctattggcgtggtgaaacagatgaagataagataaatcatgccgcaatt
gactttatcaaacgtgtcaatgccatggtccataccgactataagggagtcttgatgatt
gctgaagactcttcaagcttccctaaagtcacacatcctctagaagatggcggtattgga
tttgatatgaaatgggatctgggctggatgaatgatacactaaaattcgtggaacgccct
gctatttatcgaaaatatcactcaaatgaaatcacttttggtatgtactataaccaaaac
gagcaattcttactaccactttcgcacgacgaagttgttcatgggaaacactccattatc
gagaagatgaatggcgactacgaagataagttccatctggctcgagtctactacagcttt
tactttgcccatcctggaaagaaattactcttcatgggaaatgaatggggtcacatccgt
gaatggcacgaatatacagaaatggactggggactgctacaatttccaatccaccattct
ttctatcaaatgatgaaaacactatctactttctataaagaacatgatgctttctggaaa
tatgactaccaagcctatgaaaaaggatttaattgggtaaaaatagatgaagaagcaagc
ctgtatgctttttctcgcactagtgatgtgcaagaaatcttgactattcataactttaat
gatcaagaactatttgatgtacacttggatttgccagctgacagcgaatataaacttgtc
ttctcatctaatgctattccaatggacacatttagcctctatcccgatgaaaatggagcc
agaattactgtaccacgtttgaccagtttttatctagagcgtgtgaaataa

DBGET integrated database retrieval system