KEGG   Streptococcus suis GZ1: SSGZ1_1003Help
Entry
SSGZ1_1003        CDS       T02023                                 

Definition
putative 2-amino-4-hydroxy-6-hydroxymethylpteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ssw  Streptococcus suis GZ1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SSGZ1_1003
Enzymes [BR:ssw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SSGZ1_1003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1038814..1039302)
Genome map
AA seq 162 aa AA seqDB search
MKHLAYLSIGGNMGNRQAYLQAALDKLASHPGCQLGLVSNIYETPAWGKTDQADFLNLAC
QVYTELSAQDFLSICQNIEQELDRVRIEKWGQRTIDLDIIFWDEEKIQEENLIVPHPYAH
ERAFVLKPLAEIASDYCHPILKKVVSDLLAELGEQKDIKIFK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatctagcctatctcagtatcggagggaacatgggcaatcggcaagcctattta
caggcagccctagacaaattagccagtcatccaggttgccagcttggcttagtttccaac
atttatgaaactccagcttggggcaagaccgaccaggctgatttcctcaatctagcctgt
caagtgtatactgaattgtctgctcaggattttctaagcatttgccagaacatcgaacaa
gagttggaccgagtacggattgaaaaatggggacaacggaccattgatttggatattatt
ttttgggatgaggagaagattcaagaagagaatctgattgttcctcatccctacgcccat
gaaagagcatttgttctcaaacctcttgctgagattgcttctgattactgtcacccaatt
ttgaaaaaagtggtatcggacttgcttgcagaactaggggaacaaaaagatataaaaatt
ttcaaatag

DBGET integrated database retrieval system