KEGG   Streptococcus suis GZ1: SSGZ1_1006Help
Entry
SSGZ1_1006        CDS       T02023                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ssw  Streptococcus suis GZ1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SSGZ1_1006
Enzymes [BR:ssw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SSGZ1_1006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1040489..1041037)
Genome map
AA seq 182 aa AA seqDB search
MSKQEQIEQTIYQLLELLGEDPNREGLLDTPKRVAKMYLEMFNGLEEDPKDQFTAVFSEG
HEEVVLVKDIPFHSMCEHHLVPFYGIAHVAYIPSKGRVTGLSKLARAVEVASRRPQLQER
LTHQVAHALQDALEPEGVFVMVEAEHMCMSMRGIRKPGSKTVTTVALGNTRKMPSCAVNS
CP
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacaagaacaaatcgaacaaacaatttatcaattattagaattattgggtgag
gacccgaatcgtgaaggtttattagatacgcctaaacgggtcgctaagatgtatttagaa
atgtttaacggcctagaagaggatcccaaagaccaatttacagctgtcttttcagaaggt
catgaagaggttgttttggtcaaggatattccttttcattctatgtgtgaacaccatttg
gtacccttttatggcattgcccatgtagcttatattccgagtaaggggcgtgtgacaggt
cttagcaaattggcgcgtgcagtggaggtagcaagtcgtcgccctcaattgcaggaacgc
ttgacccatcaggttgctcatgcccttcaagatgcccttgaaccagaaggtgtttttgtc
atggtcgaagcagagcacatgtgcatgagcatgcgtggtattcgcaagccaggtagtaag
acagtgaccacagttgctcttggcaatacaaggaagatgccatcttgcgccgtgaactct
tgtccatga

DBGET integrated database retrieval system