KEGG   Streptococcus suis GZ1: SSGZ1_1015Help
Entry
SSGZ1_1015        CDS       T02023                                 

Definition
Glycoside hydrolase, family 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ssw  Streptococcus suis GZ1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssw00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SSGZ1_1015
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SSGZ1_1015
Enzymes [BR:ssw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SSGZ1_1015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1048602..1050326)
Genome map
AA seq 574 aa AA seqDB search
MPRLVDLRKKPYCLNDEQITWVENTLAHLTDEEKIGQLFVNLFFFGGDAFSGNNLSNQEL
MNRYHIGGARYMNGSPEQVQGLINELQSYSKVPLLVAANCDSGGDGAVKGGTYISSGAQS
EASRDPRIPYLAGLVSAREETALGVNVNFDPCVDIVQNWRNTIVNTRAYGTNADDVITYT
SAYLEGLTAERDVIQCIKHFPGDGKEERDQHLVLGVNELSPEEWDKSFGRVYRHHIEAGV
EMIMAGHIALPYYQQRLNPSLTDEDILPATLAPELIQDLLKEKLEFNGLVITDASHMLGM
TAAMRREDYVPAAIAAGCDMFLFFNNLEEDFEFMLNGYRKGVITDERLHDALRRILGLKA
KLNLHIKQAEGTLLKSADELAIIGCEEHLAWQREAADKAITLLKDTQKNLPISPETHRRI
RLYYLEGEKEGIMAASTEVVDNLKAALEARGYEVTVNDGTTRIKGKTLQYREEVDLALTV
ANVIGYGAQNNYRIQWKTAMSNEVPWYVHEVPTIFISLNYTTHLHDVTMVKTAINAYHHN
KNTIESLLDKLEGKDAFFGVPNENVWANKWQAKL
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgcctagattggttgatttgcggaagaaaccctattgtttgaatgatgagcagattacc
tgggtagaaaataccttggctcatctgactgatgaagaaaaaatcggtcaattgtttgtt
aatctattcttcttcggaggagacgcttttagcggaaataatctgagtaatcaggaattg
atgaatcgataccacataggtggtgcccgttatatgaatggcagtccagaacaggtacaa
ggactgattaacgagctgcaaagctattcaaaagtacctctcttggttgcagcgaactgt
gactcaggtggagatggagctgtgaaaggaggaacctatatttcctcaggtgctcaatcg
gaagccagtcgggatcctcgtattccctacctagcaggtctcgtatctgcgcgtgaggag
actgcattaggtgtaaatgtcaattttgatccttgcgtggacattgttcagaactggcgc
aatactatcgtcaataccagagcctacggtacaaatgcggatgatgttattacctatacc
agtgcctatttagaaggattgactgctgaaagagatgttattcaatgtatcaagcatttc
ccaggagatggtaaagaagaacgtgatcagcacctagtcctaggcgtcaatgagctctct
ccagaagaatgggacaagagctttggtcgtgtctatcgtcatcatattgaagctggtgtt
gagatgattatggcgggacatatagccttgccatattaccaacaacgactcaatccaagt
ttgacggacgaagatattttgcctgcaacgctggctcctgaattgatccaagatttattg
aaagaaaaactggaattcaatggcttggtcataacagatgccagccacatgttggggatg
acagcagccatgcgtcgtgaagactacgtacctgcagccattgctgcgggttgcgatatg
ttcttattcttcaataacttagaagaagattttgaatttatgctcaatggctaccgcaag
ggagtgattactgacgaacgccttcatgatgctctccgtcgcattttaggtctgaaagcc
aaactcaatctgcatatcaagcaagcggaaggaaccttactaaaatcagctgatgaattg
gctattatcggctgtgaagaacacttggcttggcaacgtgaggcggcagacaaggcaatt
acgctgttgaaagatacacagaaaaatcttccaatcagtccagaaacccatcgcagaatc
cgattgtattacctagaaggtgaaaaagaagggattatggcggcaagtacagaagtggtt
gataaccttaaagctgccttggaagcgcgtggctatgaagtgaccgtcaatgatggtacg
actcggatcaaaggaaaaacgctgcaataccgagaagaagttgatttagccttgactgtt
gccaatgtcattggatatggagcgcagaataattaccgcatccagtggaaaacggccatg
tcaaatgaagttccttggtatgtacatgaagttccaaccattttcatttcactaaactat
acaactcaccttcacgatgttaccatggtcaaaactgctatcaatgcctaccatcacaat
aaaaatactatcgaatccttacttgataaattagaaggaaaagacgcattctttggtgtg
ccaaatgagaatgtttgggccaataaatggcaggcaaaactataa

DBGET integrated database retrieval system