KEGG   Streptococcus suis GZ1: SSGZ1_1201Help
Entry
SSGZ1_1201        CDS       T02023                                 

Definition
RecR protein
Orthology
K06187  
recombination protein RecR
Organism
ssw  Streptococcus suis GZ1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ssw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SSGZ1_1201
DNA repair and recombination proteins [BR:ssw03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SSGZ1_1201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1242757..1243353)
Genome map
AA seq 198 aa AA seqDB search
MLYPTPIAKLIDSYSKLPGIGIKTATRLAFYTIGMEDDVVNEFAKNLLAAKRDLSYCSIC
GNLTDQDPCAICQDSTRDQSTILIVEDSRDVTALENIQEYHGLYHVLHGLISPMNGIGPD
DINLKTLLTRLMENEVTEVIVATNATADGEATSMYISRVLKPAGIKVTRLARGLAVGSDI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgctttaccctacacctattgccaagttaattgatagctattctaaattgccaggtatc
ggtataaaaacggctacccgtttagctttttatactattggcatggaggatgatgtcgtt
aatgagtttgcaaaaaatttattggcagccaagcgagacctatcttattgctccatttgt
ggtaatttgacagatcaggacccctgtgccatttgccaggactcaacgcgagaccagtct
actattttgattgtagaggatagtcgagatgttacagccttggaaaatatccaagagtat
cacggtctctaccatgtattgcatggcttgatttcccctatgaacgggattgggccagac
gatattaacctgaaaactctgctgacccgcttgatggaaaatgaggtgacagaggtgatt
gtggcgactaatgcaacagcagatggagaggctacatccatgtatatctcacgtgtcctt
aaacctgctggaatcaaagtaactagactagctcgtggcttagcggtaggcagtgatatt
gaatatgcagatgaagtgaccctgttgagggctattgaaaaccgcacagagctatag

DBGET integrated database retrieval system