KEGG   Streptococcus suis GZ1: SSGZ1_1451Help
Entry
SSGZ1_1451        CDS       T02023                                 

Definition
UDP-N-acetylglucosamine enolpyruvyl transferase 1
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ssw  Streptococcus suis GZ1
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssw00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SSGZ1_1451
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SSGZ1_1451
Enzymes [BR:ssw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     SSGZ1_1451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1484536..1485807)
Genome map
AA seq 423 aa AA seqDB search
MNVSMRKIVINGGKTLKGSVTVSGAKNSVVALIPAIILADGIVTLDGVPAISDVDSLVDI
METMGATVKRDGETLEIDPRGVKDMPMPFGKINSLRASYYFYGSLLGRFGQAVVGLPGGC
DLGPRPIDLHLKAFAAMGAETTYEGDYMRLATNGQRIQGAHIFMDVVSVGATINTILAAV
KAEGRTVIENAAREPEIIDVATLLNNMGARIRGAGTDIITIEGVDSLKGTRHQVIPDRIE
AGTYIALAAAVGEGIRIDNVLYEHLESYIAKLEEMGVRMTISEDSIFVEKQEKLKAVSVK
TSPYPGFATDLQQPITPLLLKAEGTGTIVDTIYEKRVGHVQELANLGAKISTRNNHIAFE
GPNQLTGTSVKATDLRAGAAMVIAGLMAQGRTEITNIEFILRGYSNIIDKLTELGADIQL
IED
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgttagtatgagaaaaattgtaattaatggtggaaaaacactgaaagggtcggtt
accgttagtggtgcaaaaaactcagttgttgctcttattccggccattattcttgcagac
gggattgttactctggacggagtacctgcaatctcggatgtagatagcttagttgatatt
atggaaacaatgggcgcgacggtcaagcgtgatggtgaaaccttggagattgaccctcgt
ggtgtaaaagacatgcctatgccatttggcaaaattaatagcttgcgtgcatcctactat
ttttacggttccctccttggtcgctttggtcaagctgttgttggcttgccaggtggttgt
gatttgggaccgcgtccgattgatttgcacttgaaagcattcgcggcaatgggagctgag
acaacctatgaaggtgactatatgcgcttggcaactaatggtcagcgtattcaaggggca
catatcttcatggatgttgtcagcgtcggtgcgacaattaatactatcttagcagctgtc
aaagcagaaggccgtacagttattgaaaatgcggcgcgtgaacctgaaattattgatgtg
gcaactttgcttaataatatgggggcacgtatccgtggtgcgggtacagatattatcacc
attgaaggcgtagatagtctaaaaggaacacgtcatcaggtgattccagaccgtattgaa
gcagggacttatattgcccttgctgctgctgttggtgaaggtattcgtatcgataatgtc
ctttatgaacacttagagagttacatcgctaagttggaagaaatgggtgttcgcatgacc
atttctgaagatagtatttttgttgaaaagcaagagaaattgaaggcggtaagtgtgaaa
acttcaccttatccaggttttgcgacagacttgcagcaacccattactcctttactgctt
aaggcagaagggactggtacgattgttgatacgatttatgaaaaacgtgttggtcatgtg
caggagcttgcaaatcttggagcaaaaatctctactcgtaacaaccatattgcctttgaa
ggtccaaatcaactgactggtacatctgttaaagctactgatttgcgtgcgggagccgca
atggttatcgctggtttaatggctcaagggcgtacagaaattacaaacattgagtttatt
ctacgtggttactcaaatattattgataaactgacagaattgggtgcagatattcaattg
attgaggattag

DBGET integrated database retrieval system