KEGG   Streptococcus suis GZ1: SSGZ1_1472Help
Entry
SSGZ1_1472        CDS       T02023                                 

Definition
(GenBank) Thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ssw  Streptococcus suis GZ1
Pathway
ssw00071  Fatty acid degradation
ssw00072  Synthesis and degradation of ketone bodies
ssw00280  Valine, leucine and isoleucine degradation
ssw00362  Benzoate degradation
ssw00380  Tryptophan metabolism
ssw00620  Pyruvate metabolism
ssw00630  Glyoxylate and dicarboxylate metabolism
ssw00640  Propanoate metabolism
ssw00650  Butanoate metabolism
ssw00900  Terpenoid backbone biosynthesis
ssw01100  Metabolic pathways
ssw01110  Biosynthesis of secondary metabolites
ssw01120  Microbial metabolism in diverse environments
ssw01130  Biosynthesis of antibiotics
ssw01200  Carbon metabolism
ssw01212  Fatty acid metabolism
ssw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ssw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSGZ1_1472
   00630 Glyoxylate and dicarboxylate metabolism
    SSGZ1_1472
   00640 Propanoate metabolism
    SSGZ1_1472
   00650 Butanoate metabolism
    SSGZ1_1472
  Lipid metabolism
   00071 Fatty acid degradation
    SSGZ1_1472
   00072 Synthesis and degradation of ketone bodies
    SSGZ1_1472
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SSGZ1_1472
   00310 Lysine degradation
    SSGZ1_1472
   00380 Tryptophan metabolism
    SSGZ1_1472
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SSGZ1_1472
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SSGZ1_1472
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SSGZ1_1472
Enzymes [BR:ssw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SSGZ1_1472
Exosome [BR:ssw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSGZ1_1472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FKBP_N
Motif
Other DBs
NCBI-ProteinID: ADE31928
UniProt: D5AJB3
Position
1501675..1502859
Genome map
AA seq 394 aa AA seqDB search
MKKVAIVSAYRSAIGSFGGSLKDIEIADLGAQVLETALASKNIPADSVDEVIFGNVLSAG
QGQNIARQIAIRAGIPQTASAYAVNKVCGSGLKSVLLAAQSIMLGDNDVVVAGGIEIMSQ
APYLSKTSRFGSKFGHITLEDSMLTDGLTDAFNDYHMGITAENVAEHYQVSRAEQDAFTY
SSQEKAAKAIAEGRFVDEIVPIRLKNRKGETIFATDEYPRLTPIEKLATLRPSFKKDGTV
TAANASGINDGCAVLILMSDEKASELNIQPLTYIEAYATSGLDPALMGLGPITASQKALQ
KLNKTVEDIDLFELNEAFAAQSIPVVKQLGIDPAKVNVNGGAIALGHPIGASGSRILVTL
IHELIKQEKELGLCSLCIGGGQGISLIVSNAQTS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagctatcgtgtctgcctatcgttctgccatcggcagtttcggaggtagt
ctgaaagatattgaaatcgctgatttaggggcgcaagtcctcgaaacagccttagctagt
aaaaacatccctgcagacagcgttgatgaagttatcttcggaaatgttctttcagcagga
caaggacaaaatattgcacgtcaaattgctattcgtgcaggcattcctcagacagcctct
gcctatgcagtcaataaagtctgtggttccggtctcaaatcagtcctcctggctgcccag
tcaatcatgctaggtgacaatgatgtagttgtggctggaggcattgaaattatgagccag
gcaccttatctatccaaaactagcaggtttggtagtaaatttggtcatattactctagaa
gattctatgctgacagacggtctaacagatgccttcaacgactatcacatgggcattact
gcagaaaatgttgctgaacactatcaagtcagtcgcgcagagcaagatgcttttacatac
agtagccaagagaaggctgcgaaagctattgctgagggaagatttgttgacgaaattgtt
cctattagattaaaaaatcggaaaggcgaaactatttttgccacagatgagtaccctcgt
ctgacgccaattgaaaaattggcaacacttcggccatcttttaaaaaggatggaaccgtc
accgcagccaatgcttctggcatcaacgacggctgtgctgtcttgatactcatgtctgat
gaaaaagccagtgagctaaatatccagccactcacctatattgaggcctatgcaacaagc
ggtttagatcccgcattgatggggcttggacctattactgctagccaaaaagcgctacaa
aaactgaataaaacagtcgaggatatcgatctattcgaactcaacgaggcatttgcagcc
caatcaattccagttgtcaaacaactcggcattgatcctgcaaaagtcaatgtcaatggt
ggtgctatcgcccttggacatccaatcggagctagtggtagtcgaatcctagtcactctg
attcacgaattaatcaagcaagaaaaagagcttggtctttgctcactttgtatcggaggc
ggtcaaggcatctccctaatcgtttccaatgcgcaaacaagttaa

DBGET integrated database retrieval system