KEGG   Streptococcus suis GZ1: SSGZ1_1839Help
Entry
SSGZ1_1839        CDS       T02023                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
ssw  Streptococcus suis GZ1
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:ssw00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    SSGZ1_1839
Enzymes [BR:ssw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     SSGZ1_1839
Amino acid related enzymes [BR:ssw01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   SSGZ1_1839
Transfer RNA biogenesis [BR:ssw03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SSGZ1_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1873614..1875119)
Genome map
AA seq 501 aa AA seqDB search
MHIYAIMFLIEILQERNMTKPIRVRYAPSPTGLLHIGNARTALFNYLFARHHGGTFLIRI
EDTDRKRHVEDGERSQLENLRWLGIDWDESPETHENYRQSERLDIYQKYVDQLLAEGKAY
KSYVTEEELAAERERQEAAGETPRYINEYLGMSEDEKTAYIAEREAAGIVPTVRLAVNEA
GIYKWNDIVKGEIEFEGGNIGGDWVIQKRDGYPTYNFAVVIDDYLMKISHVIRGDDHIAN
TPKQLMVYEALGWEAPEFGHMTLIINSETGKKLSKRDTNTLQFIEDYRRKGYMPEAVFNF
IGLLGWNPGGEEEIFSREQFIQLFDENRLSKSPAAFDQKKMDWMSNEYIKNADLETIFNL
AKPFLEEAGRLTDKAEKLVELYKPQMSSADEIVGLTDLFFSDFPELTAEEKEVMAGETVP
TVLNALKEKLEAMTDEDFQPDNIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPN
TIYLLGREKSIQHIDNMLKSL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgcatatctatgctataatgttcttgattgaaattttacaggagagaaacatgactaaa
ccaattcgtgtgcgttacgcaccaagtccaacgggacttttgcatatcggaaatgcccgt
acagcattgtttaactatctttttgcccgtcatcatggcggtactttcctcattcgtatc
gaggatacagaccgcaagcgccatgtggaagacggcgagcgttctcaacttgaaaacctg
cgttggttgggtattgactgggatgagagtccagaaacccatgagaactaccgtcagtct
gagcgtttggatatttaccaaaagtatgttgatcagctcttggcagaaggcaaggcctac
aagtcttatgtgaccgaagaagagttggcggcggagcgtgagcgtcaggaagctgcgggc
gaaacacctcgctacatcaacgaataccttggtatgtctgaggatgaaaaaactgcctac
atcgcagagcgtgaggcggctggcattgtcccaacggtccgcttggctgtcaacgaagct
ggtatctacaagtggaacgacatagttaagggtgagatcgagtttgaaggtggcaacatc
ggtggtgactgggttatccagaaacgtgacggctacccaacctacaactttgccgtggtc
attgatgattatctcatgaaaatctcgcacgttatccgtggggatgaccacattgccaac
acacccaagcagctcatggtctatgaagcacttggttgggaagcgccagaatttggtcac
atgacgcttattatcaattctgaaacaggtaaaaagttgtctaaacgtgatactaacacc
cttcagttcatcgaagattaccgccgtaaaggttacatgcctgaggctgtcttcaacttt
atcggtcttttgggttggaacccgggtggtgaagaggaaatcttctctcgtgagcaattt
atccaactcttcgatgagaaccgtctcagcaagtcacccgctgcctttgaccagaagaaa
atggactggatgagcaatgagtacatcaaaaatgctgatttagaaactattttcaacctt
gctaagccattcttggaagaagcggggcgtttgacagacaaggcagaaaaattggtggaa
ctttacaagccacagatgtcatctgcggatgaaatcgttggtttgacagaccttttcttc
tctgatttcccagaattgactgcggaagaaaaagaagtcatggcaggcgaaacggttcca
actgttctcaacgccctcaaggaaaaattggaagccatgacggacgaagatttccaacca
gataacatcttcccacaaatcaaggctgttcaaaaagaaacaggcatcaagggcaaaaac
ctcttcatgccaatccgtatcgctgtttcaggcgaaatgcatggacctgagttgccaaat
actatttacctgctcggccgtgaaaaatccatccagcatattgacaatatgttgaagagt
ttgtaa

DBGET integrated database retrieval system