KEGG   Streptococcus suis GZ1: SSGZ1_1852Help
Entry
SSGZ1_1852        CDS       T02023                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ssw  Streptococcus suis GZ1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssw00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SSGZ1_1852
   00052 Galactose metabolism
    SSGZ1_1852
   00500 Starch and sucrose metabolism
    SSGZ1_1852
   00520 Amino sugar and nucleotide sugar metabolism
    SSGZ1_1852
Enzymes [BR:ssw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SSGZ1_1852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1887063..1887710
Genome map
AA seq 215 aa AA seqDB search
MKKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALRSGIEDILVVTGKS
KRSIEDHFDSNFELEYNLKEKGKNDLLKLVDETTGIRLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITDTKAVPLTKQLMNDYEKTHASTIAVMPVPHEEVSAYGVIAPQG
EGVNGLYSVETFVEKPKPEDAPSDPCYYRTLLTHS
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttagaaaagccgttatccctgcagcaggtttgggaacacgtttcttgcct
gccactaaggctcttgccaaagaaatgttgccgattgttgataaaccaactattcaattt
atcgttgaagaagctctacgatctggtatcgaagatattttggtggtcactggtaaatca
aaacgttctatcgaagaccactttgattcaaactttgaattggaatacaacctcaaagaa
aaaggcaaaaatgatttgttgaaacttgttgatgagacaacaggcattcgactacacttc
attcgtcaaagccatccacgtggacttggtgatgccgttcttcaagctaaagcatttgtc
gggaacgagccatttgttgtcatgctgggcgatgacctcatggacatcacagatacaaaa
gctgtcccattgactaagcaactcatgaacgactatgaaaaaacacatgcttcaaccatt
gctgttatgcccgttcctcatgaagaagtttctgcatacggtgttatcgctccacaaggt
gaaggtgtcaacggtctctatagtgtggaaacctttgtggaaaaaccaaaaccagaagac
gctccttctgacccttgctattatcggacgctacttactcactcctga

DBGET integrated database retrieval system