KEGG   Streptomyces sp. SirexAA-E: SACTE_0616Help
Entry
SACTE_0616        CDS       T01601                                 

Definition
Peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SACTE_0616
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SACTE_0616
Enzymes [BR:ssx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SACTE_0616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
695896..696387
Genome map
AA seq 163 aa AA seqDB search
MTLHDIPLRTLAGEPTTLGAFEGSAVLLVNVASQCGLTPQYAGLERLQKEYAGRGFTVVG
VPCNQFAGQEPGSAEEIETFCSTTYGVSFPLLEKTEVNGEGRHPLYAELTKLTDAEGTAG
DVQWNFEKFLISPAGEPVARIRPGVEPEAPEVVSVIEANLPQR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgactctgcacgacatccctctgcgcaccctcgccggcgagcccaccacgctgggcgcc
ttcgagggttcggcggtgctgctggtgaacgtcgcgtcccagtgcgggctgaccccgcag
tacgcgggcctggagcgcctgcagaaggagtacgcgggccgggggttcaccgtggtcggc
gtaccctgcaaccagttcgcgggccaggagccgggcagcgccgaggagatcgagacgttc
tgctccacgacgtacggcgtgagcttccctctgctggagaagaccgaggtcaacggcgag
ggcaggcaccctctgtacgcggagctgacgaagctcacggacgccgagggcacggcgggc
gacgtccagtggaacttcgagaagttcctgatctcgccggccggtgagccggtcgcccgc
atccgcccgggtgtcgagccggaggcacccgaggtcgtctccgtgatcgaggcgaacctg
ccgcagcggtag

DBGET integrated database retrieval system