KEGG   Streptomyces sp. SirexAA-E: SACTE_0616Help
Entry
SACTE_0616        CDS       T01601                                 

Definition
Peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ssx00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ssx00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
695896..696387
Genome map
AA seq 163 aa AA seqDB search
MTLHDIPLRTLAGEPTTLGAFEGSAVLLVNVASQCGLTPQYAGLERLQKEYAGRGFTVVG
VPCNQFAGQEPGSAEEIETFCSTTYGVSFPLLEKTEVNGEGRHPLYAELTKLTDAEGTAG
DVQWNFEKFLISPAGEPVARIRPGVEPEAPEVVSVIEANLPQR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgactctgcacgacatccctctgcgcaccctcgccggcgagcccaccacgctgggcgcc
ttcgagggttcggcggtgctgctggtgaacgtcgcgtcccagtgcgggctgaccccgcag
tacgcgggcctggagcgcctgcagaaggagtacgcgggccgggggttcaccgtggtcggc
gtaccctgcaaccagttcgcgggccaggagccgggcagcgccgaggagatcgagacgttc
tgctccacgacgtacggcgtgagcttccctctgctggagaagaccgaggtcaacggcgag
ggcaggcaccctctgtacgcggagctgacgaagctcacggacgccgagggcacggcgggc
gacgtccagtggaacttcgagaagttcctgatctcgccggccggtgagccggtcgcccgc
atccgcccgggtgtcgagccggaggcacccgaggtcgtctccgtgatcgaggcgaacctg
ccgcagcggtag

DBGET integrated database retrieval system