KEGG   Streptomyces sp. SirexAA-E: SACTE_0622Help
Entry
SACTE_0622        CDS       T01601                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SACTE_0622
   01230 Biosynthesis of amino acids
    SACTE_0622
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACTE_0622
   00030 Pentose phosphate pathway
    SACTE_0622
   00051 Fructose and mannose metabolism
    SACTE_0622
   00052 Galactose metabolism
    SACTE_0622
  Energy metabolism
   00680 Methane metabolism
    SACTE_0622
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SACTE_0622
Enzymes [BR:ssx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SACTE_0622
Protein phosphatases and associated proteins [BR:ssx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SACTE_0622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
701457..702482
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTSGGDCPGLNAVIRSVVHRAVVDHGDEVIGFHDGWKGLLECDYRKLDLDAVGGI
LARGGTILGSSRVQPAHLRDGVERARGHVADLGLDAIIPIGGEGTLKAANLLSEAGLPIV
GVPKTIDNDIASTDVTFGFDTAVGVATDALDRLKTTAESHQRVLIVEVMGRHTGWIALHS
GMAAGAHAIVVPERPFDIDELTALVGQRFSDGKKFAIVVVAEGAKPRAGSMEFAQGTKDI
YGHERFAGVATRLSGELEQRLGKEARPVILGHVQRGGTPTAYDRVLATRFGWHAVEAAHR
GEFGMMTALHGTDISMVPLAAAVETLKTVPAERYAEAQCVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattggtgtgctcacgtccggcggcgactgccccggcctcaacgccgtcatccgt
tccgtcgtgcaccgcgcggtggtcgaccacggcgacgaggtcatcggcttccacgacggg
tggaagggcctgctcgagtgcgactaccgcaagctcgacctcgacgcggtcggcggcatc
ctcgcccggggcggcacgattctcggttcctcccgggtccagccggcacacctgcgtgac
ggggtggagcgggccaggggccacgtcgcggacctgggcctggacgcgatcatcccgatc
ggcggcgagggcacgctgaaggcggcgaatctgctgtccgaggccgggctgcccatcgtc
ggggtgcccaagaccatcgacaacgacatcgcctcgaccgacgtgaccttcggtttcgac
acggccgtcggtgtcgcgacggacgcgctcgaccggctgaagacgacggccgagtcgcac
cagcgggtgctgatcgtggaggtcatgggccgccacaccggctggatcgccctgcactcg
ggcatggccgccggagcgcacgcgatcgtggtaccggagcgccccttcgacatcgacgag
ctgaccgctctcgtcgggcagcggttctccgacggcaagaagttcgcgatcgtcgtcgtc
gcggagggcgccaagccgcgcgccggttcgatggagttcgcccagggcacgaaggacatc
tacggtcatgagcgcttcgcgggtgtggccacgcggctctcgggcgagctggagcagcgc
ctgggcaaggaggcccggccggtgatcctcggccatgtgcagcgcggtggtacgccgacc
gcctacgaccgggtgctggcgacccggttcggctggcacgcggtggaggcggcgcaccga
ggtgagttcgggatgatgacggcgctgcacggcacggacatctcgatggtgccgctggcg
gcggcggtcgagacgctgaagaccgtcccggccgagcgctacgccgaggcccagtgcgtg
ctctga

DBGET integrated database retrieval system