KEGG   Streptomyces sp. SirexAA-E: SACTE_0622Help
Entry
SACTE_0622        CDS       T01601                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00010  Glycolysis / Gluconeogenesis
ssx00030  Pentose phosphate pathway
ssx00051  Fructose and mannose metabolism
ssx00052  Galactose metabolism
ssx00680  Methane metabolism
ssx01100  Metabolic pathways
ssx01110  Biosynthesis of secondary metabolites
ssx01120  Microbial metabolism in diverse environments
ssx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACTE_0622
   00030 Pentose phosphate pathway
    SACTE_0622
   00051 Fructose and mannose metabolism
    SACTE_0622
   00052 Galactose metabolism
    SACTE_0622
  Energy metabolism
   00680 Methane metabolism
    SACTE_0622
Enzymes [BR:ssx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SACTE_0622
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     SACTE_0622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AEN08559
UniProt: G2NNC8
Position
701457..702482
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTSGGDCPGLNAVIRSVVHRAVVDHGDEVIGFHDGWKGLLECDYRKLDLDAVGGI
LARGGTILGSSRVQPAHLRDGVERARGHVADLGLDAIIPIGGEGTLKAANLLSEAGLPIV
GVPKTIDNDIASTDVTFGFDTAVGVATDALDRLKTTAESHQRVLIVEVMGRHTGWIALHS
GMAAGAHAIVVPERPFDIDELTALVGQRFSDGKKFAIVVVAEGAKPRAGSMEFAQGTKDI
YGHERFAGVATRLSGELEQRLGKEARPVILGHVQRGGTPTAYDRVLATRFGWHAVEAAHR
GEFGMMTALHGTDISMVPLAAAVETLKTVPAERYAEAQCVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattggtgtgctcacgtccggcggcgactgccccggcctcaacgccgtcatccgt
tccgtcgtgcaccgcgcggtggtcgaccacggcgacgaggtcatcggcttccacgacggg
tggaagggcctgctcgagtgcgactaccgcaagctcgacctcgacgcggtcggcggcatc
ctcgcccggggcggcacgattctcggttcctcccgggtccagccggcacacctgcgtgac
ggggtggagcgggccaggggccacgtcgcggacctgggcctggacgcgatcatcccgatc
ggcggcgagggcacgctgaaggcggcgaatctgctgtccgaggccgggctgcccatcgtc
ggggtgcccaagaccatcgacaacgacatcgcctcgaccgacgtgaccttcggtttcgac
acggccgtcggtgtcgcgacggacgcgctcgaccggctgaagacgacggccgagtcgcac
cagcgggtgctgatcgtggaggtcatgggccgccacaccggctggatcgccctgcactcg
ggcatggccgccggagcgcacgcgatcgtggtaccggagcgccccttcgacatcgacgag
ctgaccgctctcgtcgggcagcggttctccgacggcaagaagttcgcgatcgtcgtcgtc
gcggagggcgccaagccgcgcgccggttcgatggagttcgcccagggcacgaaggacatc
tacggtcatgagcgcttcgcgggtgtggccacgcggctctcgggcgagctggagcagcgc
ctgggcaaggaggcccggccggtgatcctcggccatgtgcagcgcggtggtacgccgacc
gcctacgaccgggtgctggcgacccggttcggctggcacgcggtggaggcggcgcaccga
ggtgagttcgggatgatgacggcgctgcacggcacggacatctcgatggtgccgctggcg
gcggcggtcgagacgctgaagaccgtcccggccgagcgctacgccgaggcccagtgcgtg
ctctga

DBGET integrated database retrieval system