KEGG   Streptomyces sp. SirexAA-E: SACTE_0846Help
Entry
SACTE_0846        CDS       T01601                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SACTE_0846
  Energy metabolism
   00680 Methane metabolism
    SACTE_0846
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SACTE_0846
Enzymes [BR:ssx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     SACTE_0846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
967232..968395
Genome map
AA seq 387 aa AA seqDB search
MKAVVYNGPRDVSVTEVPDARIEDPNDIVVRVTSTNICGSDLHMYEGRTSFEPGRSLGHE
NMGEVVETGPGVSKVKVGDYVVLPFNIACGFCKQCERGLTNYCLTMQPEPALAGAAYGFA
EMGPYAGGQAEYLRVPYGDFNALRLGEDAAARQNDYVMLADIFPTGYHATEMAGVKPGDR
TVVFGAGPVGLMAAYSAVLKGAGSVWVADHHEDRLELAEQVGAIPIDTREQDPAEVVKEA
TLGLGADNGCECVGYQAHDPQGEEDAALTLNQLVDSVRFTGRIGVVGVFLPEDPGGKKAQ
NALEAKGKVPFDYGLMWFKGQAMGTGQAPVKRYNRALRDLIAGGVAEPSFLVSQELPLDR
APEAYEKFDAREPGWTKVVLHPGSASA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtggtctacaacggcccgcgtgacgtcagcgtcaccgaggtccccgacgcc
aggatcgaggacccgaacgacatcgtcgtccgggtcacctccaccaacatctgcggttcc
gatctgcacatgtacgagggccgtacgtccttcgagcccggccgcagcctcgggcacgag
aacatgggcgaggtggtggagaccggccccggggtgagcaaggtgaaggtgggtgactac
gtcgtcctgcccttcaacatcgcctgcggcttctgcaagcagtgcgaacgagggctgacg
aactactgcctcaccatgcagcccgaaccggccctggccggcgccgcctacgggttcgcc
gagatgggcccgtacgccggcggtcaggcggagtacctgcgggtgccgtacggcgacttc
aacgccctgcggctcggcgaggacgcggcggcgcggcagaacgactacgtgatgctcgcg
gacatcttccccacgggttaccacgccaccgagatggccggagtgaagccgggtgaccgg
acggtggtcttcggggccggcccggtcggcctgatggccgcgtactcggccgtcctgaag
ggggcgggcagcgtatgggtcgccgaccaccacgaagaccggctggagctggccgagcag
gtgggggcgatcccgatcgacacgagggagcaggaccccgccgaggtggtcaaggaggcg
accctggggctcggcgcggacaacggctgcgagtgcgtgggctaccaggcgcacgacccc
cagggcgaggaggacgccgcgctgacgctcaatcagctcgtcgactccgtgcggttcacc
ggccgcatcggggtggtcggggtgttcctgccggaggacccgggcgggaagaaggcgcag
aacgccttggaggcgaagggcaaggtgccgttcgactacgggctcatgtggttcaagggc
caggcgatggggaccggccaggcaccggtcaagcggtacaaccgcgcgctgcgggacctc
atcgcgggcggggtggcggagccgtcgttcctcgtctcgcaggaactcccgctcgaccgg
gccccggaggcgtacgagaagttcgacgcgcgtgagccgggctggacgaaggtggtgctg
cacccggggagcgcgtcggcttag

DBGET integrated database retrieval system