KEGG   Streptomyces sp. SirexAA-E: SACTE_0883Help
Entry
SACTE_0883        CDS       T01601                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00230  Purine metabolism
ssx01100  Metabolic pathways
Module
ssx_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SACTE_0883
Enzymes [BR:ssx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SACTE_0883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 RsgA_GTPase AAA_18 AAA_29 AAA_33 AAA_22 ABC_tran AAA_30 Rad17 AAA_25 CbiA AAA_28 NTPase_1 AAA_5 CPT Zeta_toxin AAA_23 RNA_helicase AAA_24
Motif
Other DBs
NCBI-ProteinID: AEN08812
UniProt: G2N9C7
Position
complement(1010972..1011589)
Genome map
AA seq 205 aa AA seqDB search
MAATSRGTSPVPPDVRPRLTVLSGPSGVGKSTVVAHMRKVHPEVWLSVSATTRKPRPGER
NGVHYFFVDDEEFDKLIANGELLEWAEFAGNRYGTPRRAVLDRLEAGEPVLLEIDLQGAR
LVRQSMPEAQLVFLAPPTWEELVRRLTGRGTEAPDVIERRLTAARVELAAEAEFDTTLVN
TSVEDVARELLTLMLQASGLPGTDD
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaacatcccgggggacgtcccccgtacccccggacgtacgtccgcggctgacc
gtgctctccggcccctcgggggtcggcaagagcacggtcgtcgcccatatgcgcaaggtt
caccccgaggtctggctctcggtgtcggccacgacccgcaagccccggcccggcgaacgc
aacggcgtccactacttcttcgtggacgacgaggagttcgacaagctgatcgccaacggc
gagctgctggagtgggccgagttcgcgggcaaccggtacggcacgccgcgccgggccgtg
ctcgaccgcctggaggcgggcgagccggtgctgctggagatcgacctccagggcgcccgg
ctggtacgccagtcgatgcccgaggcgcagctggtcttcctggcgccgccgacctgggag
gagctggtgcgccggctcaccggccggggcaccgaggcgcccgacgtgatcgagcgccgg
ctcacggccgcgagggtcgagctggccgccgaggccgagttcgacaccacgctggtcaac
acctccgtcgaggacgtggcacgcgagctgctaacgttgatgctgcaggcttccggcctc
cccggcaccgacgactga

DBGET integrated database retrieval system