KEGG   Streptomyces sp. SirexAA-E: SACTE_0963Help
Entry
SACTE_0963        CDS       T01601                                 

Definition
NLPA lipoprotein
Orthology
K02073  
D-methionine transport system substrate-binding protein
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ABC transporters
Module
D-Methionine transport system
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SACTE_0963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1098557..1099423)
Genome map
AA seq 288 aa AA seqDB search
MRKNIKLTAAAAATAALALGLSACGTDSDPASKSESGANADTSKALVVAASPTPHADILN
YVKKNLAEKAGLKLEVKEFTDYVLPNTATENGQVDANFFQHKPYLDDFNKKNKTHIVPVV
DVHLEPLGLYSKKIKDIKDIKSGQTVAVPNDTTNEGRALQLLADNGLITLEDGVGTDAKL
SDITDKKGLTFKELEAATVPRALNDVDAAVINGNYALEADLKPATDSLALEKADGNPYAN
FLAVKEGNEKDPRVQKLAELLNSDEVKKYIEDTYQGSIVPAFGAPATS
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtaagaacatcaagctcaccgccgctgccgccgccaccgccgcgctcgccctcggg
ctcagcgcctgcggcaccgactccgaccccgcctccaagagcgagtcgggtgcgaacgcc
gacacctccaaggcgctcgtcgtcgccgcgtccccgacgccgcacgccgacatcctgaac
tacgtcaagaagaacctggcggagaaggccggactcaagctggaggtgaaggagttcacg
gactacgtcctgccgaacaccgccaccgagaacggccaggtcgacgccaacttcttccag
cacaagccctacctggacgacttcaacaagaagaacaagacccacatcgtcccggtggtc
gacgtccacctggagcccctcggtctctactccaagaagatcaaggacatcaaggacatc
aagtccggccagaccgtcgccgtgcccaacgacaccaccaacgagggccgcgcgctccag
ctgctcgccgacaacggcctgatcacgctggaggacggcgtcggcaccgacgccaagctc
agcgacatcacggacaagaagggcctgaccttcaaggagctggaggccgccaccgtgccc
cgcgccctgaacgacgtcgacgccgccgtcatcaacgggaactacgccctcgaggccgac
ctgaagccggccacggactcgctggcgctggagaaggccgacggcaacccgtacgccaac
ttcctcgccgtcaaggagggcaacgagaaggacccgcgcgtccagaagctcgccgaactc
ctcaactccgacgaggtcaagaagtacatcgaggacacctaccagggctccatcgtcccc
gccttcggcgcccccgccacctcctga

DBGET integrated database retrieval system