KEGG   Streptomyces sp. SirexAA-E: SACTE_1160Help
Entry
SACTE_1160        CDS       T01601                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ssx00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:ssx00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ssx02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1305658..1307232
Genome map
AA seq 524 aa AA seqDB search
MIDRSVSRRQMFGFGGAAAAALMLGTGAWETHSAFAAPALKGDPFTLGVASGDPTADGVV
LWTRLAPDPFAEDGLGGMPPAPVRVHYEVALDERFRRVVRRDSVVATPELAHSVHPEVHG
LAPDRTYWFRFRAGSEISPVGRTRTTPAPWDSPRRLRFAFASCQAWQDGYYTAYRHMAQE
DLDLVVHLGDYLYEYGVKTNKRGVSTDPRFHTETLDLARYRLQYGLYKSEAPLREAHAAF
PWIMTFDDHEVENNWADETSENNDDPAAFLLRRADAFQALYEHAPLRHTQLPKGPDVQMY
RRLPYGRLADFTMLDTRQYRDDQACGDGSSADCAERFDPDRTLLGARQRDWVLKGFSRSR
ARWQILGNQAPMGQTDQDPGPGTTVWTDPWDGYVAERNRLLAEADTRGVRNLVVVTGDRH
QNYAWDLKRDYSDPESATVGSEFVGTSITSGGDGDDMTAEGEKFLAANPHMKFFNNQRGY
VRVTVDRDRWTSDFRVLPFVTKPDAPISTRASVVVEDGTPGVQV
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgaccgttccgtctcccgtcggcagatgttcggattcggcggggccgcggccgcc
gcactgatgctcggaacgggtgcgtgggagacgcattccgcgttcgccgcgcccgcgttg
aagggggatccgttcaccctgggggtcgcctccggtgatccgacggcggacggcgtcgtg
ctgtggacgcggctggctcccgaccccttcgccgaggacggcctcggcggtatgccgcct
gctcccgtccgcgtccactacgaggtggcgctggacgagcggttccgccgcgtcgtacgc
cgggacagtgtcgtcgcgacccccgaactggcgcactccgtccaccccgaggtgcacggc
ctcgcccccgaccgcacgtactggttccgcttcagggcgggctcggagatctcccccgtg
ggccgcacccgcaccaccccggcgccgtgggactccccgcgccggctgaggttcgccttc
gcctcctgccaggcctggcaggacggctactacacggcctaccggcacatggcccaggag
gacctggacctggtggtgcacctgggcgactacctgtacgagtacggcgtcaagacgaac
aagcgcggggtgagcaccgacccgaggttccacacggagaccctcgacctggcccgctac
cgcctccagtacggcctctacaagtccgaggcgccgctgcgcgaggcacacgccgccttc
ccgtggatcatgaccttcgacgaccacgaggtggagaacaactgggcggacgagacctcc
gagaacaacgacgacccggcggccttcctgctccgccgggccgacgcgttccaggccctg
tacgagcacgcgccgctgcgccacacgcagctgcccaaaggccccgacgtgcagatgtac
cgcaggctcccgtacgggcggctcgccgatttcacgatgctcgacacccgccagtaccgc
gacgaccaggcctgcggcgacggctcgtcggccgactgcgccgaacggttcgacccggac
cggaccctgctcggcgcccggcagcgggactgggtcctcaagggcttcagccgctcccgg
gcgcgctggcagatcctcggcaaccaggcgccgatgggccagaccgaccaggacccgggc
ccgggcacgacggtctggacggacccgtgggacggctacgtcgccgagcgcaaccgcctg
ctggccgaggcggacacccgcggggtgcgcaacctggtcgtcgtcacgggcgaccggcac
cagaactacgcgtgggacctgaagcgcgactactccgacccggaatcggcgaccgtgggc
tcggagttcgtgggcacctcgatcacgagcggcggcgacggcgacgacatgacggccgag
ggcgagaagttcctcgcggccaacccgcacatgaagttcttcaacaaccagcgcggctac
gtgcgggtcacggtggaccgtgaccgctggacgagcgacttccgcgtcctgcccttcgtg
acgaagccggacgcgccgatcagcacgcgcgcgagcgtggtcgtggaggacgggacgccg
ggcgtccaggtctga

DBGET integrated database retrieval system