KEGG   Streptomyces sp. SirexAA-E: SACTE_1271Help
Entry
SACTE_1271        CDS       T01601                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SACTE_1271
Enzymes [BR:ssx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SACTE_1271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1428129..1428788)
Genome map
AA seq 219 aa AA seqDB search
MTDRRQDTIAQAWEDVLATARRTAAEGLVVGTSGNVSARVGDVVLVTPSGVPYDRLTPGD
TVGVDLDGRQVIGRLAPTSELPLHLAVYRATTAAAVVHTHAVHATAVSTLVTEVPAVHYA
TALLGGPVRTAAYARYGTRELAGHMLDALRDRTGCLLRNHGTVTYGDSLDQAFERTAQLE
WLCRLWLTASSVPGHRPSLLSPDQLRDVQDALEGYGQPG
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacggaccgacggcaggacacgatcgcacaggcatgggaggacgtcctcgcgacggcc
cgcaggaccgccgcggaggggctggtcgtcggcacctcgggcaacgtctcggcccgggtc
ggcgacgtcgtcctggtcacccccagcggagtgccctacgaccggctcacccccggcgac
acggtcggcgtcgacctggacggccgccaggtgatcggccgtctcgcccccaccagcgaa
ctccccctccacctcgccgtgtaccgcgccaccaccgcggccgccgtcgtgcacacccac
gccgtccacgccaccgccgtctccaccctcgtcaccgaggtcccggcggtgcactacgcc
accgccctgctcggcggccccgtccgcaccgccgcctacgcccgctacggcacccgcgaa
ctcgccggccacatgctcgacgccctccgcgaccgcaccggctgcctcctgcgcaaccac
gggaccgtcacctacggcgactccctcgaccaggccttcgagcgcaccgcccagctggaa
tggctgtgccggctctggctgaccgcgagctccgtgcccggccaccgcccgtccctgctc
tccccggaccagctgcgcgacgtccaggacgccctcgagggctacggacagcccggctga

DBGET integrated database retrieval system