KEGG   Streptomyces sp. SirexAA-E: SACTE_1276Help
Entry
SACTE_1276        CDS       T01601                                 

Definition
cobaltochelatase subunit (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ssx00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1433610..1435643
Genome map
AA seq 677 aa AA seqDB search
MSTPYPFTAIVGQDDLRLGLLLNAVSPAVGGVLVRGEKGTAKSTAVRALAALMPEVPVVA
GCRFSCDPAAPDPACPDGPHEAGAGVARPARTVELPVGASEDRLVGALDIERALSEGVKA
FEPGLLADAHRGILYVDEVNLLHDHLVDLLLDAAAMGASYVEREGVSVRHAARFLLVGTM
NPEEGELRPQLLDRFGLTVEVAASRDTDQRVEVVRRRLAYDDDPEGFAARWAEEEGALRE
RIAAARLLLPRVVLGDGVLRQIAATCAAFEVDGMRADIVMARTATALAAWAGREEVTSDD
VRQAALLALPHRRRRNPFDAPGLDEDKLDDTLREAGDDSDGDGGGDDGPGGGGGGVPPQG
GGPDAPDRGETGSDDAPVVGEGGSESGQQQPAPARGAGPEQQPVGATEPFRAKMLSVPGL
GEGAAGRRSRARTEHGRTTGARRPEGALTKLHLAATVQAAAPHQRARGRSGRGLVVRRDD
LRQATREGREGNLVLFVVDASGSMAARRRMGAVKGAVLSLLLDAYQRRDKVGLVTFRGKD
AEVALPPTSSVDAAAARLESLPTGGRTPLAAGLLKAHDVLRVERLRDPSRRPLLVVVTDG
RATGGPDPVALAARAGRLHAAEGTASVVVDCETGVVRLGLAAQLARELGGSAVTLDELRA
DSIAGLVKDVTAAGRAA
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
gtgagtacgccgtatcccttcaccgccatcgtcgggcaggacgatctgaggctcgggctg
ctgctcaacgccgtcagcccggccgtcggcggcgtcctcgtgcgcggggagaagggcact
gccaagtccaccgccgtgcgcgccctggccgccctcatgcccgaggtcccggtcgtggcc
gggtgccggttctcgtgcgacccggcggcgcccgatccggcgtgcccggacgggccgcac
gaggccggggcgggtgtcgcgcggcccgcgcggaccgtcgagctgccggtgggcgcgtcc
gaggaccggctggtcggcgcgctcgacatcgagcgggccctctcggagggcgtgaaggcc
ttcgagccgggactgctggcggacgcccaccgcgggatcctgtacgtggacgaggtcaac
ctcctccacgaccacctggtggacctgctgctcgacgcggcggccatgggtgcctcctac
gtcgagcgtgagggcgtctccgtacgccatgcggcgcggttcctgctcgtcgggacgatg
aaccccgaggagggcgagctgcggccccagctgctggaccggttcgggctgaccgtcgag
gtcgccgcgtcccgggacaccgaccagcgggtggaggtcgtgcggcgcaggctggcctac
gacgacgacccggaggggttcgccgcccggtgggccgaggaggagggcgcgctgcgggag
cggatcgccgccgcgcgcctcctgctgccccgggtggtgctgggcgacggggtgctgcgg
cagatcgccgccacctgcgcggcgttcgaggtcgacgggatgcgggccgacatcgtcatg
gcccgtaccgcgaccgcgctggccgcgtgggcgggacgtgaggaggtgacctccgacgac
gtgcggcaggccgcgctcctggcgctcccccaccggcgccgccgcaacccgttcgacgcg
cccggactggacgaggacaagctcgacgacaccctccgcgaggcgggggacgactccgac
ggcgacggtggcggcgacgacggtcccggcggagggggaggcggtgtgccgccccagggc
ggcggtcccgacgccccggaccggggcgagaccgggagcgacgacgcgccggtggtgggt
gagggcggctcggagtccgggcagcagcagcccgccccggcccggggggcaggccccgag
cagcagcccgtgggcgcgacggagcccttccgggcgaagatgctcagcgtgcccggactg
ggcgagggcgcggccggacggcggtcgcgggcccgtaccgagcacgggcggaccaccggg
gcgcgccgtcccgagggggcgctgaccaagcttcacctggcggcgaccgtgcaggcggcg
gctccgcaccagcgggcgcgcggacggtcggggcgcgggctcgtggtgcgccgtgacgat
ctgcggcaggccacacgggaggggcgcgagggcaatctcgtgctgttcgtggtggatgcc
tccgggtcgatggcggcccgccggcggatgggcgcggtgaagggtgccgtgctgtcgctg
ctgctggacgcctaccagcggcgggacaaggtggggctggtgaccttccggggcaaggac
gccgaggtggccctgccgccgacctcgtcggtggacgcggcggcggcccggctggagtcg
ctgccgaccggggggcgtaccccgctggccgccgggctgctgaaggcgcacgacgtgctg
cgggtggagcggctgcgtgatccctcgcggcgtcccctgctcgtcgtggtgacggacggc
cgggcgaccggcggccccgatccggtggcgctggccgcgcgggcgggccggctgcacgcc
gccgagggcacggcgtccgtcgtcgtggactgcgagacgggcgtcgtacgcctcggtctc
gccgcacagctcgcccgggaactgggaggcagcgccgtcacgctcgacgagctgcgggcc
gactcgatcgccgggctggtcaaggacgtcaccgcagccgggagggccgcgtaa

DBGET integrated database retrieval system