KEGG   Streptomyces sp. SirexAA-E: SACTE_1291Help
Entry
SACTE_1291        CDS       T01601                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ssx00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1450887..1452932)
Genome map
AA seq 681 aa AA seqDB search
MSHPEPAPAPLGLRKLAFGGDYNPEQWPEEVWHEDVRLMREAGVTMVSVGIFSWALLEPD
PGRYDFGWLDRLLDLLHVNGVRADLGTPTVAPPAWFYRAHPEALPVGPDGVRYAFGSRGA
ICHSSAAYREAAAGITEQLARRYAHHPALAMWHVHNEYGVPVSACYCDSCAAHFRRWLAA
RHGTVDAVNEAWGTAFWGQRYRGLDEIEPPRTTPTVGNPAQQLDYARFADATMRENFTAE
RDILHRHAPGVPVTTNFMTALSQCQSVDYWAWGREVDLVTNDHYLITDGRRTHVNLAMAA
DLTRSVAGGAPWLLLEHSTSGVNWQPRNPAKRPGEMARNSLAHVARGSEGAMFFQWRQSR
RGAEKFHSAMVPQAGTDSRVWREVSALGADLGRLAGIRGTRTVADVAMLWDWQSWWAQRL
EWRPSEDHDARERADTFYASLYDHHLTVDFAHPDADLSAYPLVVVPALYLATEETGRNLR
RYVEGGGTLVVSYFSGIVDADDAVHPGPYPGALRDVLGLTVEEFSPLLDGGTVRLTTPEG
APEGPELTGDVWSDVVIPRGAEPLWSYADGVPAGRPAITRNRLGEGSAWYVSTRLSGPDL
DTVLGRALADAGLAPRTGLARDVEVVRRTGESGTYLFAVNHSDRGADVHLDGPGTELLTG
EGVVETLAVPAGAVRVVRLDG
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacccagagcccgctcccgccccgctcggcctgcgcaagctggccttcggcggc
gactacaacccagagcagtggcccgaggaggtatggcacgaggacgtacgcctcatgcgg
gaggcgggcgtgaccatggtcagcgtcgggatcttctcctgggccctgctcgaacccgac
ccggggcggtacgacttcggctggctcgaccgcctgctggacctgctgcacgtcaacggc
gtccgcgccgacctcggcaccccgaccgtggccccaccggcctggttctaccgcgcccac
cccgaggcacttccggtcggcccggacggcgtccggtacgccttcggctcacgcggcgcg
atctgccacagctcggccgcctaccgcgaggccgcggccggcatcaccgaacagctcgcc
cgccggtacgcgcaccacccggccctcgcgatgtggcacgtccacaacgagtacggcgtc
ccggtcagcgcctgttactgcgacagctgcgccgcccacttccgccgctggctcgccgcc
cggcacggcacggtcgacgccgtcaacgaggcctggggcaccgccttctggggccagcgc
taccgcggcctcgacgagatcgagccgccccgcaccaccccgaccgtcggcaatccggcc
cagcagctggactacgcgcgcttcgccgacgccacgatgcgcgagaacttcaccgccgaa
cgcgacatcctgcaccggcacgcccccggcgtccccgtcaccaccaacttcatgaccgcg
ctcagccagtgccagtccgtcgactactgggcctggggccgcgaggtcgacctcgtcacc
aacgaccactacctgatcaccgacggccgccgcacccacgtcaacctcgcgatggccgcc
gacctcacccgctcggtggcgggcggcgcaccctggctgctgctggagcactccaccagc
ggcgtcaactggcagccccgcaaccccgccaagcgccccggcgagatggcccgcaacagc
ctggcccacgtggcacgcggctccgagggtgcgatgttcttccagtggcggcagtcccgg
cgcggcgccgagaagttccactccgcgatggtcccgcaggccggcaccgactcccgggtc
tggcgcgaggtgagcgccctgggggcggacctcggccggctggcgggcatccggggcacc
cggaccgtcgccgacgtggcgatgctgtgggactggcagtcctggtgggcccagcggctg
gagtggcggcccagcgaggaccacgacgcccgtgaacgcgccgacaccttctacgcctcg
ctctacgaccaccacctcaccgtcgacttcgcccaccccgacgccgacctgtccgcctac
cccctggtcgtcgtccccgccctctacctcgccaccgaggagaccggccgcaacctgcgc
cgttacgtcgagggcggcggcaccctcgtcgtctcgtacttctccgggatcgtcgacgcc
gacgacgccgtgcaccccggtccctaccccggcgccctacgggacgtcctgggcctgacc
gtcgaggagttctcccccctcctcgacggcggcacggtccgcctgaccacccccgagggc
gcgcccgagggcccggagctgaccggtgacgtctggtcggacgtggtgatcccgcgcggc
gccgagcccctctggtcgtacgccgacggcgtcccggccggccgtcccgcgatcacccgc
aaccggctcggcgagggcagcgcctggtacgtctccacccggctgagcggcccggacctg
gacaccgtgctgggccgggcgctcgccgacgcgggtctcgcgccgcgcaccggtctcgcc
cgggacgtcgaggtcgtgcgccgcacgggggagagcggcacctacctcttcgcggtcaac
cactccgaccgcggggccgacgtgcacctcgacggccccggcaccgaactcctcaccggc
gagggcgtggtggagacgctcgccgtgccggcgggcgcggtccgcgtcgtacggctcgac
ggctga

DBGET integrated database retrieval system