KEGG   Streptomyces sp. SirexAA-E: SACTE_1311Help
Entry
SACTE_1311        CDS       T01601                                 

Definition
Pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ssx00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ssx00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1471543..1472640)
Genome map
AA seq 365 aa AA seqDB search
MTSRRSALSLLAGAGAALAVGAPSAHARAARPRPFGRHGSPARRLDARTLYVDPHGRGDH
TDVRSALDAATGSGRTLVIAPGTYRGPVTVPADRAGLTLIGASGDARDTVLVHDNAAGTP
KPDGSGTLGTSGSATVTVQAAGLTVRDVTFSNDWLRSDNPEYTGTQAVAIKVQGDRSAFY
GCRFLGHQDTLYADSLSLTAFARQYYRDCYVEGDVDFVFGRATAVYDRCHFRTLTRTDLA
SAPYGFVFAPSTAGANPHGFLVLRSRVTSTAPDAYYKLARPWVPSSDLTAHPMLTVRDTY
LGPGIDAVTPYADMSADFPWQEQRFAEHRNTGPGARVTAPADRPQLSASEARAHTPAGWL
GDWRP
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcagacgcagtgccctctccctgctcgcgggcgcgggcgccgccctcgccgtc
ggcgccccctccgcccacgcccgggccgcccgcccccgccccttcggccgccacggttca
ccggcccgccgcctcgacgcccgcacgctgtacgtcgatccgcacggcaggggcgaccac
accgacgtacggtcggccctcgacgccgccaccggcagcggccgcaccctggtgatcgcc
cccggcacctaccgcggccccgtcaccgtgcccgccgaccgggcgggcctcaccctgatc
ggcgcgagcggcgacgcccgcgacaccgtcctggtccacgacaacgcggccggcacgccc
aagcccgacggctccggcaccctgggtaccagcggttcggccaccgtcaccgtccaggcc
gccggcctcaccgtccgcgacgtgaccttctccaacgactggctgcgctccgacaacccg
gagtacaccggcacccaggccgtcgcgatcaaggtccagggcgaccgctcggcgttctac
ggctgccgcttcctcggccaccaggacaccctgtacgccgactccctctcgctgaccgcg
ttcgcccgccagtactaccgcgactgctacgtggagggcgacgtcgacttcgtgttcggc
cgcgccaccgccgtctacgaccgctgccacttccgcaccctgacccgcaccgacctcgcc
tcggccccgtacggcttcgtcttcgcgcccagcaccgccggggccaacccgcacggcttc
ctggtgctgcgttcccgcgtcaccagcaccgcccccgacgcgtactacaagctggcccgc
ccctgggtgccgtcctccgacctcacggcccacccgatgctgaccgtccgcgacacgtac
ctgggcccgggcatcgacgcggtcaccccgtacgccgacatgtcggccgacttcccgtgg
caggaacagcgcttcgccgaacaccgcaacaccggccccggcgcccgcgtcaccgccccc
gccgaccggccgcagctcagcgcgtcggaagcacgcgcgcacaccccggccggctggctg
ggggactggcgcccgtag

DBGET integrated database retrieval system