KEGG   Streptomyces sp. SirexAA-E: SACTE_1367Help
Entry
SACTE_1367        CDS       T01601                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00010  Glycolysis / Gluconeogenesis
ssx00051  Fructose and mannose metabolism
ssx00562  Inositol phosphate metabolism
ssx01100  Metabolic pathways
ssx01110  Biosynthesis of secondary metabolites
ssx01120  Microbial metabolism in diverse environments
ssx01130  Biosynthesis of antibiotics
ssx01200  Carbon metabolism
ssx01230  Biosynthesis of amino acids
Module
ssx_M00002  Glycolysis, core module involving three-carbon compounds
ssx_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACTE_1367
   00051 Fructose and mannose metabolism
    SACTE_1367
   00562 Inositol phosphate metabolism
    SACTE_1367
Enzymes [BR:ssx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SACTE_1367
Exosome [BR:ssx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SACTE_1367
  Exosomal proteins of bladder cancer cells
   SACTE_1367
  Exosomal proteins of melanoma cells
   SACTE_1367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEN09285
UniProt: G2NH31
Position
complement(1525895..1526671)
Genome map
AA seq 258 aa AA seqDB search
MTTRTPLMAGNWKMNLNHLEAIAHVQKLAFALADKDYEAVEVAVLPPFTDLRSVQTLVDG
DKLKIKYGAQDISAQDSGAYTGEISGPMLAKLKCTYVAVGHSERRQYHGENDEICNAKVK
AAYKHGLTPILCVGEGLDVRKAGDQVSYTLAQLDGGLKDIPAEQAESIVIAYEPVWAIGT
GEVATPEDAQEVCGAIRGRLAELYSQELADAVRIQYGGSVKSGNVAAIMAQPDVDGALIG
GAALDADEFVKIVRFRDQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccgcaccccgctgatggcgggcaactggaagatgaacctcaaccacctcgag
gccatcgcccacgtccagaagctcgccttcgccctggccgacaaggactacgaggccgtc
gaggtcgccgtcctgccgcccttcaccgacctgcgctccgtgcagaccctggtcgacggc
gacaagctgaagatcaagtacggcgcccaggacatctcggcccaggactccggcgcgtac
accggtgagatctccggcccgatgctcgccaagctgaagtgcacctacgtggccgtcggc
cacagcgagcgccgccagtaccacggtgagaacgacgagatctgcaacgccaaggtcaag
gccgcctacaagcacggtctgaccccgatcctctgcgtcggcgaggggctggacgtccgc
aaggccggggaccaggtctcctacacgctcgcgcagctcgacggcggcctgaaggacatc
ccggccgaacaggccgagtccatcgtgatcgcctacgagccggtctgggccatcggtacc
ggcgaggtcgccaccccggaggacgcccaggaggtctgcggcgcgatccgcggccggctc
gccgagctgtactcgcaggagctcgcggacgccgtccgtatccagtacggcggctcggtg
aagtccggcaacgtggccgccatcatggcgcagcccgacgtggacggtgcgctcatcggg
ggcgccgcactggacgccgacgagttcgtcaagatcgtccgcttccgcgaccagtga

DBGET integrated database retrieval system