KEGG   Streptomyces sp. SirexAA-E: SACTE_1554Help
Entry
SACTE_1554        CDS       T01601                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
ssx  Streptomyces sp. SirexAA-E
Brite
Enzymes [BR:ssx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SACTE_1554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1738667..1739446
Genome map
AA seq 259 aa AA seqDB search
MPVLPGAEPFRHEGGEVGVLLCHGFTGSPQSLRPWAEYLAERGLTVSLPLLPGHGTRWQD
MAVTGWQDWYAEVDRELRALRDRCAQVFVFGLSMGGALALRLAAKHGDTVSGLVLVNPAN
KVHGLSAYALPLARHLVRTTKGLANDIALENSDEIGYDRVPLHAAHSLRTFFRLVDGELP
QVIQPLVLLHSPQDHVVPPADSARILSRVSSTDVEEILLEQSYHVATLDHDAERIFGESY
RFIGRLAPSVGKKGSTSGG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgccggtcctccccggagccgagccgttccgccacgagggcggagaggtcggcgtcctc
ctctgtcacggattcaccggttcaccgcagtcgctgcgcccctgggccgagtacctggcc
gagcgcggcctgaccgtgtcgctcccgctgctgcccggtcacggcacgcgctggcaggac
atggcggtcaccggctggcaggactggtacgcggaggtggaccgggagctgcgggcgctg
cgggaccgctgcgcccaggtcttcgtcttcggcctgtcgatgggcggggcgctggcgctg
cgcctggccgccaagcacggggacaccgtctccggcctggtgctggtcaacccggcgaac
aaggtgcacggcctgtcggcgtacgccctgcctctcgcccggcacctggtgcggacgacg
aaggggctggcgaacgacatcgccctggagaactccgacgagatcggctacgaccgggtg
ccactgcacgcggcgcactccctgcggacgttcttccggctggtggacggcgaactgccg
caggtcatccagccgctggtgctgctgcacagcccgcaggaccacgtcgtgccgccggcc
gactcggcgcggatcctgagccgggtgtcctcgacggacgtcgaggagatcctcctggaa
cagagctaccacgtcgcgacgttggaccacgatgcggagcggatcttcggcgagagctac
cggttcatcggccgcctcgcacccagcgtcggcaagaaggggagcacgtccggtggctga

DBGET integrated database retrieval system