KEGG   Streptomyces sp. SirexAA-E: SACTE_1605Help
Entry
SACTE_1605        CDS       T01601                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SACTE_1605
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SACTE_1605
  Amino acid metabolism
   00310 Lysine degradation
    SACTE_1605
Enzymes [BR:ssx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SACTE_1605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1793575..1795401
Genome map
AA seq 608 aa AA seqDB search
MSVSVTLPALGESVTEGTVTRWLKAEGERVEADEPLLEVSTDKVDTEIPAPAAGVLTSIK
VAEDETVEVGAELAVIDDGSGAPAAEEAPAAEPAAVPAPAAEEAPTAPSTETEAPAEAPS
AQDTAGASSASGTDVTLPALGESVTEGTVTRWLKEVGEEVAEDEPLLEVSTDKVDTEIPA
PVAGVLLEIVVGEDETAEVGAKLAVIGAPGAAPAAAPAPAAPAPAEEKPAAPAPAPAAET
PAPAAPAPAEEKPAAPAPAPAPAAPAPAPAAQAPAAPAAPAPAAAPAAAAPAASAGDEGA
YVTPLVRKLAAENGVDLGSVKGTGVGGRIRKQDVVAAAEAAKAAAAAPAPAPAAAPAAAK
KAPKLEASPLRGQTVKMTRMRKVIGDNMMKALHSQAQLTSVLEVDITKLMKLRNQAKESF
AAREGVKLSPMPFFVKAAAQALKAHPVVNARINEDEGTITYFDSENIGIAVDAEKGLMTP
VIKGAGDLNIAGIAKKTAELAGKARGGGLTPDDMSGATFTVSNTGSRGALFDTVIVPPNQ
AAILGIGATVKRPAVIETAEGTVIGVRDMTYLSLSYDHRLVDGADAARYLTTVKAILEAG
EFEVELGL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtttccgtaacccttccggcgctcggcgagagcgtcaccgagggcactgtcacc
cgttggctgaaggccgagggcgagcgcgtcgaggccgacgagccgctgctcgaggtctcg
accgacaaggtcgacaccgagatccccgcacccgccgccggcgtcctgacctccatcaag
gtcgccgaggacgagaccgtcgaggtcggcgccgagctggccgtcatcgacgacggctcg
ggcgcgcccgccgccgaggaggccccggccgccgagcccgcggccgtcccggccccggcc
gccgaggaggcgcccaccgccccgtcgacggagacggaggccccggccgaggctccgtcc
gcgcaggacaccgccggtgcctcgtccgcctccggtacggacgtcacccttccggcgctc
ggcgagagcgtcaccgagggcaccgtcacccgctggctgaaggaggtcggcgaggaggtc
gcggaggacgagccgctgctcgaggtctccacggacaaggtcgacaccgagatccccgcg
ccggtcgccggtgtgctgctggagatcgtcgtcggtgaggacgagaccgccgaggtcggc
gccaagctggccgtcatcggtgctccgggcgctgccccggccgccgccccggctccggcc
gccccggcacccgccgaggagaagcccgccgctccggcgcccgccccggccgccgagacc
ccggctccggccgccccggcacccgccgaggagaagccggccgctccggctccggctccg
gctccggctgctcccgcgcccgccccggccgcccaggccccggccgctcccgccgctccg
gcgcccgccgccgctccggccgcggccgctccggccgcgtccgccggtgacgagggtgcc
tacgtcacgccgctggtgcgcaagctcgccgccgagaacggtgtcgacctgggctcggtc
aagggcaccggtgtcggtggccgcatccgcaagcaggacgtcgtcgccgccgcggaggcc
gccaaggccgccgcagccgctccggctcccgcccccgcggccgcccccgccgcggcgaag
aaggcgccgaagctcgaggcgtccccgctgcgcggtcagacggtcaagatgacccgcatg
cgcaaggtcatcggcgacaacatgatgaaggcgctgcactcgcaggcccagctgacctcg
gtcctcgaggtcgacatcaccaagctgatgaagctgcgcaaccaggcgaaggagtccttc
gccgcccgtgagggcgtcaagctgtccccgatgccgttcttcgtgaaggcggcggcccag
gcgctgaaggcccacccggtcgtcaacgcccggatcaacgaggacgagggcaccatcacg
tacttcgactcggagaacatcggcatcgccgtggacgccgagaagggtctgatgaccccg
gtcatcaagggtgcgggcgacctgaacatcgccggtatcgcgaagaagaccgccgagctg
gccggcaaggcccgcggtggcggcctcaccccggacgacatgtccggtgccaccttcacg
gtcagcaacaccggttcgcgcggtgcgctgttcgacaccgtcatcgtgccgccgaaccag
gccgccatcctgggcatcggcgccaccgtcaagcgtccggcggtcatcgagaccgccgag
ggcaccgtcatcggcgtccgcgacatgacgtacctgtcgctctcctacgaccaccgtctg
gtggacggcgcggacgccgcccgttacctgaccacggtcaaggcgatcctcgaagcaggc
gagttcgaggtcgagctgggtctctga

DBGET integrated database retrieval system