KEGG   Streptomyces sp. SirexAA-E: SACTE_1699Help
Entry
SACTE_1699        CDS       T01601                                 

Definition
Heme oxygenase (EC:1.14.99.3)
Orthology
K00510  
heme oxygenase [EC:1.14.99.3]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Porphyrin and chlorophyll metabolism
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ssx00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1898332..1899012
Genome map
AA seq 226 aa AA seqDB search
MDATATPATAPSTPFSTLIRTASHEQHTEAESSTFMSDMLGGRLGVDAYARYTEQLWFVY
RALEDGADALREDPVAGPFIQPELMRTAELERDLAHLRGEAWREGLEPLPATAAYAERVA
ECARDWPAGYIAHHYTRYLGDLSGGQIIRGTAEKTWGFERKGDGVRFYVFEQISNPAAFK
REYRELLDAVNADDLEKQRIIDECKRAFALNTAVFHELGEAFPLSA
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
ttggacgcaaccgccacccccgcgaccgctcccagcacccctttctcgacgctgatccgt
accgcgtcgcacgagcagcacaccgaggcggagtcctccaccttcatgagcgacatgctc
ggcgggcggctcggggtggacgcgtacgcgcgctacacggagcagctgtggttcgtctac
cgggctctggaggacggcgccgacgccctgcgcgaggacccggtggcgggccccttcata
cagcccgagctgatgcgcacggccgagctggagcgggacctcgcccatctgcggggcgag
gcgtggcgcgagggcctggagccgctgccggccacggccgcgtacgcggagcgggtcgcc
gagtgcgcccgtgactggccggccggctacatcgcgcaccactacacccgctacctcggt
gacctctccggcggccagatcatccggggcacggcggagaagacctggggcttcgagcgc
aagggcgacggggtgcgcttctacgtcttcgagcagatctccaacccggccgccttcaag
cgggagtaccgggagctgctggacgcggtgaacgccgacgacctggagaagcagcgcatc
atcgacgagtgcaagcgcgccttcgcgctgaacaccgccgtcttccacgagctgggcgag
gccttcccgctcagcgcctga

DBGET integrated database retrieval system