KEGG   Streptomyces sp. SirexAA-E: SACTE_1699Help
Entry
SACTE_1699        CDS       T01601                                 

Definition
Heme oxygenase (EC:1.14.99.3)
Orthology
K00510  
heme oxygenase [EC:1.14.99.3]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Porphyrin and chlorophyll metabolism
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SACTE_1699
Enzymes [BR:ssx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.3  heme oxygenase (biliverdin-producing)
     SACTE_1699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1898332..1899012
Genome map
AA seq 226 aa AA seqDB search
MDATATPATAPSTPFSTLIRTASHEQHTEAESSTFMSDMLGGRLGVDAYARYTEQLWFVY
RALEDGADALREDPVAGPFIQPELMRTAELERDLAHLRGEAWREGLEPLPATAAYAERVA
ECARDWPAGYIAHHYTRYLGDLSGGQIIRGTAEKTWGFERKGDGVRFYVFEQISNPAAFK
REYRELLDAVNADDLEKQRIIDECKRAFALNTAVFHELGEAFPLSA
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
ttggacgcaaccgccacccccgcgaccgctcccagcacccctttctcgacgctgatccgt
accgcgtcgcacgagcagcacaccgaggcggagtcctccaccttcatgagcgacatgctc
ggcgggcggctcggggtggacgcgtacgcgcgctacacggagcagctgtggttcgtctac
cgggctctggaggacggcgccgacgccctgcgcgaggacccggtggcgggccccttcata
cagcccgagctgatgcgcacggccgagctggagcgggacctcgcccatctgcggggcgag
gcgtggcgcgagggcctggagccgctgccggccacggccgcgtacgcggagcgggtcgcc
gagtgcgcccgtgactggccggccggctacatcgcgcaccactacacccgctacctcggt
gacctctccggcggccagatcatccggggcacggcggagaagacctggggcttcgagcgc
aagggcgacggggtgcgcttctacgtcttcgagcagatctccaacccggccgccttcaag
cgggagtaccgggagctgctggacgcggtgaacgccgacgacctggagaagcagcgcatc
atcgacgagtgcaagcgcgccttcgcgctgaacaccgccgtcttccacgagctgggcgag
gccttcccgctcagcgcctga

DBGET integrated database retrieval system