KEGG   Streptomyces sp. SirexAA-E: SACTE_1699Help
Entry
SACTE_1699        CDS       T01601                                 

Definition
(GenBank) Heme oxygenase (EC:1.14.99.3)
  KO
K00510  
heme oxygenase (biliverdin-producing) [EC:1.14.14.18]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Porphyrin and chlorophyll metabolism
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SACTE_1699
Enzymes [BR:ssx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     SACTE_1699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1898332..1899012
Genome map
AA seq 226 aa AA seqDB search
MDATATPATAPSTPFSTLIRTASHEQHTEAESSTFMSDMLGGRLGVDAYARYTEQLWFVY
RALEDGADALREDPVAGPFIQPELMRTAELERDLAHLRGEAWREGLEPLPATAAYAERVA
ECARDWPAGYIAHHYTRYLGDLSGGQIIRGTAEKTWGFERKGDGVRFYVFEQISNPAAFK
REYRELLDAVNADDLEKQRIIDECKRAFALNTAVFHELGEAFPLSA
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
ttggacgcaaccgccacccccgcgaccgctcccagcacccctttctcgacgctgatccgt
accgcgtcgcacgagcagcacaccgaggcggagtcctccaccttcatgagcgacatgctc
ggcgggcggctcggggtggacgcgtacgcgcgctacacggagcagctgtggttcgtctac
cgggctctggaggacggcgccgacgccctgcgcgaggacccggtggcgggccccttcata
cagcccgagctgatgcgcacggccgagctggagcgggacctcgcccatctgcggggcgag
gcgtggcgcgagggcctggagccgctgccggccacggccgcgtacgcggagcgggtcgcc
gagtgcgcccgtgactggccggccggctacatcgcgcaccactacacccgctacctcggt
gacctctccggcggccagatcatccggggcacggcggagaagacctggggcttcgagcgc
aagggcgacggggtgcgcttctacgtcttcgagcagatctccaacccggccgccttcaag
cgggagtaccgggagctgctggacgcggtgaacgccgacgacctggagaagcagcgcatc
atcgacgagtgcaagcgcgccttcgcgctgaacaccgccgtcttccacgagctgggcgag
gccttcccgctcagcgcctga

DBGET integrated database retrieval system