KEGG   Streptomyces sp. SirexAA-E: SACTE_1713Help
Entry
SACTE_1713        CDS       T01601                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SACTE_1713
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SACTE_1713
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SACTE_1713
Enzymes [BR:ssx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SACTE_1713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1913431..1915098)
Genome map
AA seq 555 aa AA seqDB search
MTPAQIRTATGRQGHSAAFRTAARRIGAGLDRRRFLTVTGAAAALAFAAELPAAGTASAA
ELDARKIADDPFTLGVASGDPLPDSVLLWTRLAPRPYEADGSLPARRVQVGWEIARDERF
RSPVRRGTATAHPEFGHSVHVDARGLEPDRVFYYRFRAGNWTSPTGRTRTAPSPDARTSS
LTLAAVSCQAYHDGYYTAYRHLAAEDVDVVFHLGDYLYEYAVNSAGGARGYTDRVLPAHF
NRETLTLDDYRMRYGLYKSDPDLRAAHAAHPFVVTWDDHETENNYAGDTPENDVPPEEFL
LRRAAAYRAYWENQPLRTPQRPTGPDMRLYRRLRFGRLAQFDVLDTRQYRSNQAYGDGWK
VPGPESEDPARTMTGAAQERWLIDGWKQSRALWNVVPQQVTFARRRDVPTDAYKLSMDSW
DGYPASRQRLMDGAEAAGIENLMVLTGDVHVGYGFDLKKDFDDPASRTVGTEIVATSITS
GKDGAEKPANWNNLTQANPHLRFYNGRRGYVLVDLDRERARADFRTVAAVTTPGAPVTTA
GSFVTEAGNPGLVPA
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgacacccgcacagatccgcaccgccaccggtcggcagggccattccgccgcgttccgc
accgccgcccggcggatcggggccggcctggaccgccggcgtttcctcaccgtcaccggt
gcggccgcagcgctggccttcgccgccgagctccccgccgccggcaccgcgagcgccgcc
gagctggacgcccggaagatcgccgacgaccccttcaccctcggcgtggcctccggcgac
ccactgcccgactccgtcctgctgtggaccagactcgcgccccgcccctacgaggccgac
ggctcactgcccgcccggagggtccaggtcggctgggagatcgcccgcgacgagcgcttc
cggagccccgtccgacgcggaacggccaccgcccacccggagttcggccacagcgtccac
gtcgacgcccggggcctcgaacccgaccgggtcttctactaccgcttccgcgccggcaac
tggaccagccccaccggccgcacccgcaccgcgccctcacccgacgcccgcaccagctcg
ctcaccctcgccgccgtctcctgccaggcgtaccacgacggctactacaccgcctaccgg
cacctcgccgccgaggacgtcgacgtcgtcttccacctcggcgactacctctacgagtac
gccgtcaactccgcgggcggcgcccgcggctacaccgaccgcgtcctgccggcccacttc
aaccgtgagacgctcacgctggacgactaccggatgcgctacggcctctacaagtccgac
ccggacctgcgcgccgcccacgccgcgcaccccttcgtcgtcacctgggacgaccacgag
accgagaacaactacgcgggggacacccccgagaacgacgtcccgcccgaggagttcctg
ctgcgccgggcggccgcctaccgcgcgtactgggagaaccagccgctgcgcaccccgcag
cgccccaccggccccgacatgcggctctaccggcgcctccggttcggccggctcgcccag
ttcgacgtgctcgacacccgccagtaccgcagcaaccaggcctacggcgacggctggaag
gtccccgggccggagtccgaggacccggcgcgcaccatgacgggcgccgcccaggaacgc
tggctgatcgacggctggaagcagtcgcgggccctgtggaacgtcgtgccccagcaggtc
accttcgcccggcggcgcgacgtgccgaccgacgcctacaagctgtccatggactcctgg
gacggctacccggcctcccggcagcggctcatggacggcgccgaggccgccgggatcgag
aacctgatggtcctcaccggcgacgtgcacgtcggctacggcttcgacctgaagaaggac
ttcgacgacccggcctcccggaccgtcggtaccgagatcgtggccacctcgatcaccagc
ggcaaggacggcgccgagaaaccggccaactggaacaacctcacccaggccaacccgcac
ctgaggttctacaacggccgccgcggctacgtgctcgtcgacctcgaccgggagcgggcg
cgcgccgacttccgcacggtggccgcggtcaccacgcccggcgcgcccgtcaccacggcc
gggtccttcgtgaccgaggccgggaacccggggctcgtccccgcctga

DBGET integrated database retrieval system