KEGG   Streptomyces sp. SirexAA-E: SACTE_1892Help
Entry
SACTE_1892        CDS       T01601                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00010  Glycolysis / Gluconeogenesis
ssx00052  Galactose metabolism
ssx01100  Metabolic pathways
ssx01110  Biosynthesis of secondary metabolites
ssx01120  Microbial metabolism in diverse environments
ssx01130  Biosynthesis of antibiotics
Module
ssx_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACTE_1892
   00052 Galactose metabolism
    SACTE_1892
Enzymes [BR:ssx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SACTE_1892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEN09798
UniProt: G2NBW1
Position
2098810..2099832
Genome map
AA seq 340 aa AA seqDB search
MTTGTVIRSEDFTPRADGTPVRRWILERDGTLVRILTYGAVVQSVEVPGRDGTRAGVALG
LKDTAGYEAHPGPYFGALVGRYANRIRGGSFVLDGHTRQVTRNEGRNHVHGGTRGFDKRV
WDAEEVPDGVRLSLVAEDGEEGFPGRLTVSVTYTLAAGGALRIGYRAATDAPTVLNLTNH
TYWNLAGADSGSALGHELRLAAGAITPVDAESLPTGEFAPVDGTRFDFREAKPVGPGYDV
NYVLDRTGGKPVAELYDAGSGRLLTVWTTEPGLQLYTADHFDGRPFPACAGIALETQHFP
DSPNRPEFPSTVLRPGEEFTSTTVYGFSVRGEAVSGRGRG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgggcaccgtgatacgcagcgaggacttcacccccagggccgacggcaccccc
gtccggcgctggattctggagcgtgacggcaccctggtccggatcctgacgtacggcgcc
gtggtgcagtccgtcgaggtgcccgggcgggacggcacccgggccggggtggcgctgggg
ctcaaggacaccgccgggtacgaggcgcacccgggaccgtacttcggcgcactggtcggg
cggtacgcgaaccggatccggggcggctcgttcgtgctcgacgggcacacgcgccaggtg
acccggaacgagggccgcaaccacgtgcacggcgggacgcgcggcttcgacaagcgggtg
tgggacgccgaggaggtgccggacggcgtacggctgtcgctggtcgccgaggacggcgag
gagggcttcccgggacggctcacggtctcggtgacgtacaccctggcggcgggaggggcg
ctgcggatcggctaccgggcggccacggacgcgccgaccgtgctgaacctgaccaaccac
acgtactggaacctggcgggcgcggacagcggcagcgcgctcggccacgaactgcggctc
gcggccggggccatcacaccggtggacgcggagtccctccccacgggggagttcgcaccg
gtggacgggacccgcttcgacttccgcgaggcgaagccggtggggcccgggtacgacgtc
aactacgtgctggaccgcacgggcgggaagccggtggccgagctgtacgacgccgggtcg
ggccggctgctgacggtgtggacgacggagcccggactccagctgtacaccgcggaccac
ttcgacgggcggccgttcccggcgtgcgccgggatcgcgctggagacgcagcacttcccc
gactccccgaaccggccggagttcccgagcacggtgctgcggccgggcgaggagttcacg
tccaccacggtgtacggcttctcggtgcgcggagaggccgtcagcgggcgaggccgaggg
tga

DBGET integrated database retrieval system