KEGG   Streptomyces sp. SirexAA-E: SACTE_2078Help
Entry
SACTE_2078        CDS       T01601                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SACTE_2078
Enzymes [BR:ssx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SACTE_2078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2312795..2314951)
Genome map
AA seq 718 aa AA seqDB search
MGLSRLAALHGVATSFSPSAGVTVPVPDSTVTAVLAALGVDADTPAEVGRSLSAAESAAA
SRLLPPTVVVWSGEPLPAALAALPPDAELTVEPERPPGATEAPSRLRMRVPKALAPAPPD
GGTPTWWTEPPPGVHRATVRASGHRYATAVLVVAPDRVPQPPACTHGFLVQLYSLLSARS
WGMGDLADLADLAAWSGRTLGTGFVQVNPLHAAVPGSPTDPSPYRPSSRRFPDPVHLHIE
SVPEYGHVRDRAALDDLRLDAAALSDAVLNKGALIDRDAVWELKKQALELVARVPLSPGR
RAAYCDYLAEQGQDLEDHALWCALAEVHGPRWRDWPEGLRDPRSARTARARTELMDRVDL
HCRLAWLTDTQLAAAQQAAREAGMAVGVVHDLAVGVHPDGADTWAQQEAFAHGMSVGAPP
DAFNARGQDWGLPPWRPDALAASGYAPYRALLRGILAHAGALRIDHVMGLFRLWWVPEGR
PPTEGTYVSHDAEAMLAVLVLEAHRAGAAVVGEDLGTVEPGVREALARRGVLGTSVLWFE
RDWDGDGRPLAPERWRRDCVATATTHDLPSTAARLTGDHVTLRHRLGLLTRPLEQELAED
VTGTTEWLSCLARLRLLPEGEGDEEAAVRAVHRFLLRTPARMTGIWLPDTVGDRRPQNLP
GTWDQYPNWRLPVADAEGHPVTLEEIAASPRLHRLMEVFRPPAESSGVRTAPPGARRP
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgggcttgtcccggctcgccgcactgcacggcgtcgccacctccttctccccgtccgcg
ggcgtcacggtgcccgttcccgacagcacggtcacagccgtgctcgccgcgctgggcgtc
gacgccgacacgcccgcggaggtgggaaggtcgctctccgcggccgaatccgcggcggcc
tcccggctgctcccgcccaccgtggtggtctggtcgggagagccgctgccggccgcgctg
gccgcgctgccccccgacgcggagctcaccgtggagcccgagcgcccgcccggcgccacc
gaggccccgtcgcggctgcggatgcgggtcccgaaggccctcgcaccggcgcccccggac
ggggggacacccacctggtggaccgaaccgccccccggtgtccaccgggcgaccgtccgc
gcatccggacaccgctacgccaccgccgttctcgtcgtcgctccggaccgcgtaccccag
ccgcccgcctgtacgcacggcttcctcgtccagctctactcgctgctctccgcccgctcc
tggggcatgggcgacctcgccgacctggccgatctggccgcctggtcgggccggaccctg
ggcaccggattcgtccaggtcaacccgctgcacgcggccgtgcccggcagccccaccgac
ccctcgccgtaccgcccctcctcccggcgcttccccgacccggtgcacctgcacatcgag
tccgtcccggagtacgggcacgtgcgcgaccgggcggccctggacgacctgcggctggac
gcggcggccctgagcgacgccgtgctcaacaagggcgcgctgatcgaccgggacgcggtc
tgggagctcaagaagcaggcgctggagctcgtcgcccgggtcccgctcagccccggacgc
cgcgccgcctactgcgactacctcgccgagcagggccaggacctggaggaccacgccctg
tggtgcgccctggccgaggtgcacggcccgcggtggcgcgactggcccgaggggctgcgt
gacccgcgctcggcgaggaccgcccgcgcccgcaccgagctgatggaccgggtcgacctc
cactgccggctggcctggctgacggacacccagctcgccgctgcccagcaggccgcgcgg
gaggccgggatggccgtgggggtcgtccacgacctcgccgtcggcgtccacccggacggc
gccgacacctgggcccagcaggaggccttcgcgcacggcatgtccgtcggcgcgcccccg
gacgccttcaacgcgcggggccaggactggggtctgcccccgtggcgccccgacgccctg
gccgcgtccggatacgccccctaccgcgcgctcctgcgcggcatcctcgcccacgcgggc
gccctgcgcatcgaccatgtgatgggcctcttccggctctggtgggtgcccgagggccgt
ccgcccaccgaaggcacctacgtcagccacgacgccgaggcgatgctcgccgtcctcgtc
ctggaggcgcaccgggccggtgccgccgtggtgggggaggacctcggcacggtcgagccg
ggtgtgcgcgaggcgctggcccggcgcggggtgctcggcacctccgtgctctggttcgag
cgcgactgggacggcgacggacggcccctggcccccgagcggtggcgccgggactgcgtg
gccaccgcgaccacccacgacctgccgtccacggccgcccggctgacgggcgaccatgtg
acgctccgccaccgcctcggactgctgacccgccctctggagcaggagctggccgaggac
gtcaccggcaccaccgagtggctgtcctgtctggcacggctccggctgctgcccgaaggg
gagggggacgaggaggcggccgtccgggccgtccaccgcttcctgctgcgcacccccgcc
cggatgaccgggatctggctccccgacaccgtcggcgaccgccgcccccagaacctcccg
ggcacctgggaccagtaccccaactggcgcctgcccgtcgccgacgcggagggccacccc
gtcaccctggaggagatcgcggcgtcgccccggctgcaccggctgatggaggtcttccgg
ccgccggcggagagctccggggtccgtacggcacccccgggcgcgcgccgtccgtag

DBGET integrated database retrieval system