KEGG   Streptomyces sp. SirexAA-E: SACTE_2173Help
Entry
SACTE_2173        CDS       T01601                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SACTE_2173
Enzymes [BR:ssx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SACTE_2173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2424494..2426749)
Genome map
AA seq 751 aa AA seqDB search
MAPDTVTPMSHTAVLEGVLERITYANEENGYTVARVDTGRGSGDLLTVVGSLLGAQPGES
LRMEGRWASHPQFGKQFQVDNYTTVLPATIQGIRRYLGSGLIKGIGPVMADRITTHFGVD
TLDIIEQHPKRLVEVPGLGPKRTKMIAAAWEEQKAIKEVMVFLQSVGVSTSIAVRIYKKY
EDASISVVRNQPYRLAADVWGIGFLTADRIAQAVGIPHDSPERVKAGLQYALSQSTDQGH
CFLPEERLIADGVKLLQVDTGLVIECLAELAEDPEGVVREKVPGPEDGQPVTAVYLVPFH
RAEISLATQVRRLLHTPEDRMPAFGDVDWDKALAWLARRTGAKLAPEQEAAVRLALSRKV
AVLTGGPGCGKSFTVRSVVELARAKHAKVVLAAPTGRAAKRLSELTGAEASTVHRLLELK
PGGDAAYDRERPLDADLVVVDEASMLDLLLANKLVKAVAPGAHLLLVGDVDQLPSVGAGE
VLRDLLAKDGPVPSVRLTTIFRQAQRSGVVTNAHRINAGVPPITQGLSDFFLFVEDETED
AGVLAVDVAARRIPAKFGLDPRRDVQVLAPMHRGPAGAGHLNGLLQQAVTPGRPDLPEKR
FGGRVFRVGDKVTQIRNNYEKGENGVFNGTVGVVTALDTDEQTLTVRTDEDEEIGYDFDE
LDELSHAYAMTIHRSQGSEYPAVVVPVTTSAWMMLQRNLLYTAVTRAKKLVVLVGSRKAI
GQAVRTVSAGRRCTGLAFRLRGGAAGDFAEK
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcccgataccgtcacacccatgtcccacacggccgtgctggaaggcgtcctggag
cgcatcacctacgccaacgaggagaacgggtacaccgtcgcccgcgtcgacaccgggcgc
gggagcggcgacctgctcaccgtcgtcggatcgctgctgggcgcacagcccggcgagtcc
ctgcggatggaggggcgttgggcctcgcacccgcagttcggcaagcagttccaggtggac
aactacacgacggtcctgccggccacgatccagggcatccgccgctacctcggctccggc
ctgatcaagggcatcgggccggtgatggccgaccgcatcaccacccacttcggcgtggac
accctggacatcatcgagcagcacccgaagcggctcgtcgaggtgcccggactcggcccg
aagcggacgaagatgatcgccgcggcctgggaggaacagaaggcgatcaaggaggtcatg
gtcttcctccagagcgtcggcgtctcgacctccatcgccgtgcgcatctacaagaagtac
gaggacgcctcgatctccgtcgtgcggaaccagccctaccggctggccgccgacgtctgg
ggtatcggcttcctcaccgccgaccgcatcgcccaggccgtcggcatcccgcacgacagc
ccggaacgggtcaaggcgggcctccagtacgcgctgtcgcagtccaccgaccaggggcac
tgcttcctccccgaggaacgcctcatcgcggacggggtgaagctcctccaggtcgacacg
gggctcgtcatcgaatgcctggccgaactggccgaggacccggagggcgtcgtacgggag
aaggtcccgggccccgaggacgggcagcccgtcaccgccgtgtacctggtgcccttccac
cgcgccgagatctcgctcgccacccaggtgcggcgtctgctgcacacaccggaggaccgg
atgccggccttcggggacgtcgactgggacaaggcgctggcctggctcgcccggcgtacg
ggggcgaagctggcgcccgagcaggaggccgccgtccggctcgcgctcagccgcaaggtc
gccgtcctgaccggcggtcccggctgcggcaagtcgttcaccgtccgttccgtcgtggag
ctggcccgcgccaagcacgccaaggtggtgctggccgcgcccaccggccgggcggcgaag
cggctctcggagctgaccggcgccgaggcgtccaccgtgcaccggctgctggagctgaag
cccggcggggacgccgcgtacgaccgggaacggccgctggacgccgacctggtggtcgtc
gacgaggcgtcgatgctcgatctgctgctcgccaacaagctcgtcaaggcggtggcaccc
ggtgcccacctcctcctggtcggggacgtggaccagctgccgtcggtcggcgcgggggag
gtgctgcgcgatctgctcgcgaaggacggcccggtgccctccgtccggctgaccacgatc
ttccggcaggcccagcggtccggggtcgtcaccaacgcccaccgcatcaacgcgggggtc
ccgccgatcacccaggggctgagcgacttcttcctgttcgtggaggacgagaccgaggac
gcgggggtgctcgccgtggacgtcgcggcccgccgcatccccgccaagttcggcctggac
ccccgccgtgacgtgcaggtactcgccccgatgcaccgcggcccggcgggtgcgggacat
ctgaacggactgctccagcaggccgtcaccccgggccgccccgatctgccggagaagcgg
ttcggcggccgggtcttccgcgtcggcgacaaggtcacccagatccgcaacaactacgag
aagggcgagaacggcgtcttcaacggcacggtcggcgtggtcaccgccctcgacacggac
gagcagacgctgaccgtccgcacggacgaggacgaggagatcgggtacgacttcgacgag
ctcgacgagctgtcccacgcctacgccatgacgatccatcgctcccagggcagcgagtac
ccggcggtcgtcgtcccggtcaccaccagcgcctggatgatgctccagcggaacctgctg
tacacggcggtgaccagggcgaagaagctcgtcgtcctggtcggttcgcgcaaggccatc
gggcaggcggtccgcacggtttccgccggcagacgctgtacgggactggctttccggctg
cgcggaggcgcggcaggagacttcgcggaaaaatga

DBGET integrated database retrieval system