KEGG   Streptomyces sp. SirexAA-E: SACTE_2238Help
Entry
SACTE_2238        CDS       T01601                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SACTE_2238
Enzymes [BR:ssx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SACTE_2238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2505230..2506198)
Genome map
AA seq 322 aa AA seqDB search
MSSTDSPRGPVDSSRIPRYAGPATFARLPRLDEVGSADVAVVGVPFDSGVSYRPGARFGG
NAIREASRLLRPYNPAQDASPFALAQVADAGDVAANPFDIHEAVETVEAAADDLLATGAR
LMTLGGDHTIALPLLRSVAKKHGPVALLHFDAHLDTWDTYFGAEYTHGTPFRRAVEEGVL
DTEALSHVGTRGPLYGKKDLTDDAKMGFGIVTSADVMRRGVDEIADQLRQRIGDRPLYIS
IDIDVLDPAHAPGTGTPEAGGLTSRELLEILRGLSSCHLVSADLVEVAPAYDHAEITSVA
ASHTAYELTTIMARQIAGGRSA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaccgactcgccgcgcggccccgtcgactcctcccgcatcccgcggtacgcc
gggcccgcgacgttcgcccggctgccccggctggacgaggtcggctccgccgatgtcgcc
gtcgtcggcgtgcccttcgacagcggggtctcctaccgtcccggcgcccgcttcgggggc
aacgcgatccgggaggcctcccgcctcctgcggccctacaacccggcgcaggacgcctct
cccttcgcgctggcccaggtcgccgacgcgggggacgtcgccgcgaacccgttcgacatc
cacgaggcggtcgagaccgtcgaggccgccgccgacgacctgctcgcgaccggcgcccgc
ctgatgaccctgggcggcgaccacaccatcgccctgccgctgctgcgctccgtcgccaag
aagcacggccccgtcgccctgctccacttcgacgcccacctcgacacctgggacacctac
ttcggggccgagtacacccacggcaccccgttccgtcgggccgtcgaggagggcgtcctc
gacaccgaggcgctctcccacgtcggcacccgcggcccgctgtacggcaagaaggacctc
accgacgacgccaagatgggcttcggcatcgtgacctccgccgacgtcatgcggcgcggc
gtcgacgagatcgccgaccagctgcggcagcgcatcggcgaccggccgctctacatctcc
atcgacatcgacgtcctggacccggcgcacgcccccggcaccggcacccccgaggccggc
ggcctcacctcgcgcgagctcctggagattttgcgcgggctctcctcctgccacctggtc
tccgccgacctggtcgaggtggcaccggcgtacgaccacgccgagatcacctccgtcgcc
gcctcgcacacggcgtacgagctgacgacgatcatggcccggcagatcgcggggggccgt
tccgcgtga

DBGET integrated database retrieval system