KEGG   Streptomyces sp. SirexAA-E: SACTE_2394Help
Entry
SACTE_2394        CDS       T01601                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SACTE_2394
Enzymes [BR:ssx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     SACTE_2394
    3.5.1.-  
     SACTE_2394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2670812..2671396
Genome map
AA seq 194 aa AA seqDB search
MHRALIVVDVQNDFCEGGSLAVAGGADVAAAITDLIGEAQPGYRHVVATRDHHIDPGGHF
SATPDFEDSWPPHCVAGTEGVGFHPNFAPAVASGAIDTVFDKGAYEAAYSGFEGTDENGT
GLAQWLRERSVTAVDVVGIATDHCVRATALDAVREGFETHVLLDLTAGVAEGTTERALEE
LRAAGVELSGKPVV
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgcgccttgatcgtcgtcgacgttcagaacgacttctgcgagggcggcagcctc
gcggtggcgggcggcgccgatgtcgccgccgccatcaccgacctgatcggcgaggcccag
cccggttaccgccacgtcgtggccacccgcgaccaccacatcgacccgggcggccacttc
tccgcaacgcccgatttcgaggactcctggccgccgcactgcgtggcgggcacggagggc
gtcggcttccacccgaacttcgccccggccgtcgcctccggcgccatcgacacggtgttc
gacaagggtgcgtacgaggccgcctacagcggcttcgaaggcaccgacgagaacggcacc
ggcctcgcccagtggctgcgggagcggtccgtcaccgccgtcgacgtcgtcggtatcgcc
acggaccactgcgtgcgggccaccgcgctcgacgcggtccgtgagggcttcgagacccat
gtgctgctggacctgacggcgggcgtcgccgaggggacgaccgagcgggcactggaggag
ctgcgggcggcgggcgtggagctgtcgggcaagcccgtcgtctga

DBGET integrated database retrieval system