KEGG   Streptomyces sp. SirexAA-E: SACTE_2394Help
Entry
SACTE_2394        CDS       T01601                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:ssx00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2670812..2671396
Genome map
AA seq 194 aa AA seqDB search
MHRALIVVDVQNDFCEGGSLAVAGGADVAAAITDLIGEAQPGYRHVVATRDHHIDPGGHF
SATPDFEDSWPPHCVAGTEGVGFHPNFAPAVASGAIDTVFDKGAYEAAYSGFEGTDENGT
GLAQWLRERSVTAVDVVGIATDHCVRATALDAVREGFETHVLLDLTAGVAEGTTERALEE
LRAAGVELSGKPVV
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgcgccttgatcgtcgtcgacgttcagaacgacttctgcgagggcggcagcctc
gcggtggcgggcggcgccgatgtcgccgccgccatcaccgacctgatcggcgaggcccag
cccggttaccgccacgtcgtggccacccgcgaccaccacatcgacccgggcggccacttc
tccgcaacgcccgatttcgaggactcctggccgccgcactgcgtggcgggcacggagggc
gtcggcttccacccgaacttcgccccggccgtcgcctccggcgccatcgacacggtgttc
gacaagggtgcgtacgaggccgcctacagcggcttcgaaggcaccgacgagaacggcacc
ggcctcgcccagtggctgcgggagcggtccgtcaccgccgtcgacgtcgtcggtatcgcc
acggaccactgcgtgcgggccaccgcgctcgacgcggtccgtgagggcttcgagacccat
gtgctgctggacctgacggcgggcgtcgccgaggggacgaccgagcgggcactggaggag
ctgcgggcggcgggcgtggagctgtcgggcaagcccgtcgtctga

DBGET integrated database retrieval system