KEGG   Streptomyces sp. SirexAA-E: SACTE_2577Help
Entry
SACTE_2577        CDS       T01601                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2909308..2910213)
Genome map
AA seq 301 aa AA seqDB search
MSGGPVSPYGFVGVRGRGYRPEQVDRAVAALSGEREEALERLARLTALAEELTAESARLR
EVVASLAPQTYVSLGERAQRILALAEEEAEAARAAAAEEAQALRDAADAAGRAAKEAARA
EAASVRAAADEEAGTLLGGARDTGESLVREALEEAGRVRGEADAEMAETRRRTAGVLAHQ
EREHAERGKAADEELAAAEAVVAAREAELAERGEALLARARRELSEAEEAARHRQEDAEA
QAAGLLSEARVAEERVGRETDRVLREHEEAREEVRSHMAHVRTALASLTGRTLPDREPAE
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtggaccggtgtccccgtacggcttcgtgggcgtgcgggggcgtggttaccgt
ccggagcaggtggaccgtgccgttgccgcgctgtcgggcgagcgggaagaggcgctggag
aggctggcccggctgacggctctggccgaggagttgacggcggagtcggcgcggctgcgt
gaggtggtcgcgtcgctggcgccgcagacgtatgtgtcgctgggggagcgggcccagcgg
atcctggcgctggccgaggaggaggccgaggcggcccgggccgcggcggcggaggaggcg
caggcgctgcgggacgcggcggacgcggcgggccgggcggcgaaggaggcggcgcgcgcg
gaggcggcttcggtgcgggcggcggccgacgaggaggccgggacgctgctcggtggggcg
cgggacacgggcgagtcgctggtgcgggaggccttggaggaggccggccgggtccgcggg
gaggcggatgcggagatggccgagacccgtcgccgtacggcgggggtgctggcccatcag
gagagggagcacgcggagcggggcaaggcggccgacgaggagctggcggcggccgaggcc
gtggtggcggcgcgcgaggcggagctggcggagcggggcgaggcgttgctggcgcgggcc
cggcgggagctctcggaggcggaggaggccgcccggcaccgtcaggaggacgcggaggcg
caggcggccgggctgctgtccgaggcgcgggtggccgaggagcgggtgggccgggagacg
gaccgggtgctgcgggagcacgaggaggcccgcgaggaggtgcggtcccacatggcgcac
gtgcggacggcgctggcgtcgctgacgggccgtacgctgccggaccgggagccggccgag
ggctga

DBGET integrated database retrieval system