KEGG   Streptomyces sp. SirexAA-E: SACTE_2586Help
Entry
SACTE_2586        CDS       T01601                                 

Definition
(GenBank) ribosomal 5S rRNA E-loop binding protein Ctc/L25/TL5
  KO
K02897  
large subunit ribosomal protein L25
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    SACTE_2586
Ribosome [BR:ssx03011]
 Ribosomal Proteins
  Bacteria
   Large subunit
    SACTE_2586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2920405..2920989
Genome map
AA seq 194 aa AA seqDB search
MAEIKLATEVRTEFGKGAARRIRRANQVPGVVYGHGAEPVHVTLPGHDLLLALRTPNVLI
GLEIDGKDALVIPKAVQRNAIKGDIEHVDLLTVKRGEKVNVEVAVHAEGDLAPGANLLEF
VMNTLLVEAEATHIPESVTVSVAGLDAGASVLAKDIPLPSGSVLAEDPEAVVLAVVAAQS
EPASDEAAAEGEEA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggccgagatcaagctcgccaccgaggtccgtaccgagttcggcaagggcgccgcccgc
cgtatccgtcgggccaaccaggttcccggtgtggtctacggccacggcgccgagccggtc
cacgtcacgctgccgggtcacgacctgctgctggcgctgcgtacgccgaacgtcctgatc
ggtctggagatcgacggcaaggacgccctggtcatcccgaaggccgtccagcgcaacgcc
atcaagggcgacatcgagcacgtcgacctgctgaccgtgaagcgcggcgagaaggtcaac
gtcgaggtcgcggtgcacgccgagggcgacctggcgccgggtgcgaacctgctcgagttc
gtgatgaacacgctgctcgtcgaggccgaggccacccacatccccgagtcggtcacggtc
tccgtggcgggcctggacgccggtgcgtcggtgctggcgaaggacatcccgctgccgtcc
ggttcggtgctggccgaggacccggaggccgtcgtgctggccgtcgtggccgcgcagtcc
gagccggcgtccgacgaggccgccgccgagggcgaagaggcctga

DBGET integrated database retrieval system