KEGG   Streptomyces sp. SirexAA-E: SACTE_2588Help
Entry
SACTE_2588        CDS       T01601                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2921785..2922255
Genome map
AA seq 156 aa AA seqDB search
MKRSTSHRLLDHGRTFAAGCVVLLLLVAGAWASWGTAHHVVLSKGREHGTMSVTGCGDDM
CTGSFAPDERSERRAGVTIERSVAVRRGDRFPVVVKPGTGEVVRTGVPGFLHAWVPLGGA
LVLSALVLAGGMRLTRTAWGAGVAGAALLAATFFAL
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggagcacgtcccaccggctgttggaccatggccgtacgttcgcggccggctgt
gtcgtcctgttgttgctcgtggcgggggcgtgggcgtcgtgggggacggcgcatcacgtc
gtgctgtccaaggggcgtgagcacgggacgatgtcggtcacggggtgtggtgacgacatg
tgtacggggtcgttcgcgccggacgagcggtccgagcggcgggccggggtgacgatcgag
aggtccgtcgcggtgcgcaggggtgaccgtttcccggtggtggtgaagccggggaccggg
gaggtcgtgcggacgggtgtgccggggttcctgcacgcgtgggtgccgctcggcggtgcg
ctggtgctgtcggcgctggtgctcgcgggcgggatgcggctgacgcggacggcgtggggt
gcgggtgtcgcgggtgcggccctgctggcggcgacgttcttcgcgctgtga

DBGET integrated database retrieval system