KEGG   Streptomyces sp. SirexAA-E: SACTE_2589Help
Entry
SACTE_2589        CDS       T01601                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SACTE_2589
  Energy metabolism
   00680 Methane metabolism
    SACTE_2589
Enzymes [BR:ssx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SACTE_2589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2922286..2925015)
Genome map
AA seq 909 aa AA seqDB search
MSSADQTPAANTELRADIRRLGDLLGETLVRQEGPELLDLVERVRALTRTDGEAAAQLLG
DTDLETAAQLVRAFSTYFHLANVTEQVHRAHEMRDRRAAEGGLLARTADRLKDADPEHLR
ETVKNLNVRPVFTAHPTEAARRSVLNKLRRIAALLETPVIEADRRRQDLRLAENIDLIWQ
TDELRVVRPEPADEARNAIYYLDELHANAVGDVLEDLAAELERVGVELPAGTRPLTFGTW
IGGDRDGNPNVTPKVTWDVLILQHEHGITDALELIDHLRGLLSNSIRYTGATDELLTSLQ
TDLELLPEISPRYKRLNAEEPYRLKATCIRQKLVNTRERLATGTPHRPGCDYLGTSELIA
DLTLIQTSLREHRGGLFADGRMDRTIRTLSAFGLQLATMDVREHADAHHHALGQLFDRLG
EESWRYADMPRDYRQKLLAKELRSRRPLAPTPAPLDAAGEKTLGVFHTITQAFERFGPEV
IESYIISMCQGADDVFAAAVLAREAGLIDLHAGWAKIGIVPLLETTDELKAADVILDDML
ADPSYRRLVSLRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRLRLFH
GRGGTVGRGGGPSHDAILAQPWGTLEGEIKVTEQGEVISDKYLIPALARENLELTVAATL
QASALHTAPRQSDEALARWDAAMDTVSDAAHTAYRKLVEDPDLPAYFLASTPVDQLADLH
LGSRPSRRPGSGVSLDGLRAIPWVFGWTQSRQIVPGWFGVGSGLKALREAGLDTVLEEMH
GQWHFFQNFLSNVEMTLAKTDLRIARHYVDTLVPDELKHVFDVIEAEHELTVQEVLKVTG
GKELLGTSPVLQQTFAIRDAYLDPISYLQVSLLARQRQAAERGEEPDPLLARALLLTVNG
VAAGLRNTG
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgaccagacacccgccgccaacaccgaactccgggccgacatccgacgc
ctcggcgacctcctgggcgagaccctcgtacgccaggagggccccgaactcctcgacctc
gtcgaacgcgtccgagccctcacccgcaccgacggcgaagcggccgcccagctcctcggc
gacaccgacctggagaccgccgcccagctcgtacgcgccttctccacctacttccacctc
gccaacgtcaccgagcaggtccaccgcgcccacgagatgcgcgaccgccgagccgcggaa
ggcggactgctcgcccgcaccgccgaccggctcaaggacgccgaccccgagcacctgcgc
gagacggtcaagaacctcaacgtccggcccgtcttcaccgcccaccccaccgaagcggcc
cgccgctccgtgctcaacaagctccgccgcatcgccgcactcctcgaaacccccgtcatc
gaggccgaccgccgccgccaggacctgcggctcgccgagaacatcgacctcatctggcag
accgacgagctccgcgtcgtacggcccgagcccgccgacgaggcccgcaacgccatctac
tacctcgacgaactccacgcgaacgccgtcggcgacgtcctggaggacctcgccgccgaa
ctcgaacgcgtcggcgtcgaactccccgccggcacccgccccctcaccttcggcacctgg
atcggcggcgaccgcgacggcaaccccaacgtgacccccaaggtcacctgggacgtgctg
atcctccagcacgaacacggcatcaccgacgccctcgaactcatcgaccacctgcgcgga
ctgctctccaactccatccgctacaccggagccaccgacgagctcctcacctccctccag
accgacctggaactcctcccggagatcagcccccgctacaagcggctcaacgccgaagag
ccctaccggctcaaggccacctgcatccgccagaagctcgtcaacacccgcgaacgcctc
gccaccggtaccccccaccgccccggctgcgactacctcggcacctccgaactcatcgcc
gacctgaccctcatccagacctccctgcgcgagcaccgcggcggactcttcgccgacggc
cgcatggaccgcaccatccggaccctgtccgcgttcggcctccagctcgccaccatggac
gtacgcgaacacgccgacgcccaccaccacgccctcggccagctcttcgaccggctcggc
gaggaatcctggcgctacgccgacatgccccgcgactaccggcagaagctcctcgccaag
gaactccgctcccgccgccccctcgcccccaccccggcacccctcgacgccgccggcgag
aagaccctcggcgtcttccacaccatcacccaggccttcgaacgcttcggccccgaagtc
atcgagtcctacatcatctccatgtgccagggcgccgacgacgtcttcgccgccgccgtc
ctcgcccgcgaagccggcctcatcgacctccacgccggctgggccaagatcggcatcgtg
ccgctcctggagaccaccgacgagctcaaggccgccgacgtcatcctcgacgacatgctc
gccgacccctcctaccgccgcctcgtctcactccgcggcgacgtccaggaggtcatgctc
ggctactccgactcctccaagttcggcggcatcaccacctcccagtgggagatccaccgc
gcccagcgacgcctccgcgacgtcgcccaccgctacggcgtacgcctgcgcctcttccac
ggccgcggcggcaccgtcggccgcggcggcggcccctcccacgacgcgatcctcgcccag
ccctggggcaccctcgaaggcgagatcaaggtcaccgaacagggcgaggtcatctccgac
aagtacctcatcccggccctcgcccgcgagaacctggaactgaccgtcgcggccaccctc
caggcctccgccctgcacaccgcgccccgccagtccgacgaagccctcgcccgctgggac
gcggccatggacaccgtctccgacgccgcccacaccgcctaccgcaagctcgtcgaagac
cccgacctgcccgcgtacttcctcgcctccaccccggtcgaccaactcgccgacctgcac
ctgggctcgcggccctcccgccgccccggctcaggcgtctcgctcgacggactccgcgcc
atcccctgggtgttcggctggacccagtcacgccagatcgtccccggctggttcggcgtc
ggctcaggcctcaaggcactgcgcgaagccggactcgacaccgtcctggaagaaatgcac
ggacagtggcacttcttccagaacttcctctccaacgtcgagatgaccctcgccaagacc
gacctgcgcatcgcccgccactacgtggacaccctcgtccccgacgagctcaagcacgtc
ttcgacgtcatcgaggccgagcacgaactcaccgtgcaggaagtcctcaaggtcaccggc
ggcaaggaactcctcggcaccagccccgtcctccagcagaccttcgccatccgcgacgcc
tacctggaccccatctcctacctccaggtatcgctcctggcccgccagcgccaggccgcc
gaacgcggcgaagagcccgaccccctgctcgcccgagccctgctgctcaccgtcaacggc
gtcgccgcaggactccgtaacaccggctga

DBGET integrated database retrieval system