KEGG   Streptomyces sp. SirexAA-E: SACTE_2590Help
Entry
SACTE_2590        CDS       T01601                                 

Definition
Stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SACTE_2590
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SACTE_2590
Enzymes [BR:ssx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     SACTE_2590
Lipid biosynthesis proteins [BR:ssx01004]
 Desaturase
  First
   SACTE_2590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2925387..2926373
Genome map
AA seq 328 aa AA seqDB search
MTTSPDVLDDGMPSAGPASAPPSATLGGDNKRSIEQIALLLFIVVPFAALVAAVPLAWGW
GISWLDLSLMVVMYYIGCHGVTIGFHRYFTHGSFKANRPLRIALAVAGSMAVEGPVVRWV
ADHRKHHRFSDAEGDPHSPWRFGESLPALLKGMWWAHIGWMFNEEQTPQQKYAPDLIKDP
AIRGISRHFVSFTILSLGIPPLVGGLVTMSWWGAFTAFFWGSLVRVALLHHVTWSINSIC
HAVGKRPFKSRDRSGNVWWLAVLSCGESWHNLHHADPTCARHGVLRGQIDSSARLIRWFE
QLGWARDVRWPDASRIASRRKPAGAHPA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccagccccgatgtgctcgacgacggcatgccgtcggccggccccgcatccgca
cccccctccgccacgctcggcggggacaacaagcgttcgatcgagcagatcgcgctgctg
ctgttcatcgtggtgcccttcgccgctctggtcgcggcggtgccgctggcctggggctgg
gggatcagctggctggacctgtccctgatggtcgtcatgtactacatcggctgccacgga
gtgacgatcggcttccaccgctacttcacccacggctccttcaaggcgaaccggccgctg
cgcatcgccctggccgtcgcgggctccatggccgtcgagggtccggtggtccgctgggtg
gccgaccaccgcaagcaccaccggttctccgacgccgagggcgacccgcattcgccgtgg
cggttcggcgagagcctcccggccttgctcaagggcatgtggtgggcgcacatcggctgg
atgttcaacgaggagcagaccccgcagcagaagtacgcgcccgacctgatcaaggacccg
gcgatccgggggatctcgcgccacttcgtgagcttcacgatcctctcgctggggatcccg
cccctggtcggcggtctggtgacgatgtcctggtggggtgcgttcaccgcgttcttctgg
gggtcgctggtccgggtggcgctgctgcaccacgtgacctggtcgatcaactcgatctgc
cacgcggtcggcaagcggccgttcaagtcccgtgaccgctcgggcaacgtgtggtggctc
gcggtgctctcgtgcggcgagtcctggcacaacctccaccacgcggacccgacgtgcgcc
cggcacggggtgctgcgggggcagatcgattccagcgcccggctgatccgctggttcgag
cagctgggctgggcgcgcgacgtgcgctggccggatgcctcacgtatcgcctcccggcgc
aagcccgcgggcgcccaccctgcatga

DBGET integrated database retrieval system