KEGG   Streptomyces sp. SirexAA-E: SACTE_2593Help
Entry
SACTE_2593        CDS       T01601                                 

Definition
(GenBank) Trans-aconitate 2-methyltransferase
  KO
K00598  
trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
ssx  Streptomyces sp. SirexAA-E
Brite
Enzymes [BR:ssx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     SACTE_2593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2927417..2928211)
Genome map
AA seq 264 aa AA seqDB search
MTAPLWDPQQYLRHADHRTRPFHDLLARVGPLPRPTPRIADLGCGAGNVTALLAADRPEA
RVTGYDNSTRMLEQARTHAGPRLDFAEADVATWEPEETYDLIVSNALLQWVPGHTGLFPR
WLDALVPGGVLAFQVPGNFDAPSHTLLRELADSPRWHGTLGGLLRHGDAVETPEDYLARL
TGHGCESDVWETTYLHLLRGEDPVLDWVKGTALRPVLTALADDPEARDAFVLEYRDLLRD
AYPAGPHGTVLPFRRVFAVARVAG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaccgctgtgggacccccagcagtacctccgccacgccgaccaccgcacccgg
cccttccacgacctgctggcccgcgtcgggccgctgccacgccccacgccgcgcatcgcc
gacctcggctgcggcgccgggaacgtcaccgccctgctcgccgcagaccggccggaggcc
cgcgtcaccggctacgacaactccacccggatgctggagcaggcccgtacccacgccggg
ccccgcctcgacttcgccgaggccgacgtcgcgacctgggagcccgaggagacgtacgac
ctgatcgtctccaacgccctgctccaatgggtccccggccacaccggcctcttcccccgc
tggctggacgccctggtccccggcggcgtcctcgccttccaggtcccgggcaacttcgac
gcccccagccacaccctgctgcgcgaactcgccgactccccgcgctggcacgggaccctc
ggcggcctgctgcgccacggcgacgcggtcgagacccctgaggactacctcgcccggctc
accggccacggatgcgagagcgacgtctgggagaccacctacctgcacctcctgcggggc
gaggacccggtcctggactgggtgaagggcaccgccctgcgccccgtcctcaccgccctg
gccgacgaccccgaagcccgcgacgccttcgtcctggaataccgcgacctgctgcgcgac
gcctacccggcgggcccgcacggcacggtcctgcccttccggcgcgtcttcgccgtggcc
cgggtcgcggggtga

DBGET integrated database retrieval system