KEGG   Streptomyces sp. SirexAA-E: SACTE_2597Help
Entry
SACTE_2597        CDS       T01601                                 

Definition
(GenBank) galactokinase
  KO
K00849  
galactokinase [EC:2.7.1.6]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Galactose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, galactose => UDP-galactose
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SACTE_2597
   00520 Amino sugar and nucleotide sugar metabolism
    SACTE_2597
Enzymes [BR:ssx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.6  galactokinase
     SACTE_2597
Exosome [BR:ssx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SACTE_2597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2930230..2931414)
Genome map
AA seq 394 aa AA seqDB search
MTDNAELTASFTELYGRAPEGIWAAPGRVNLIGEYTDFNDGFVMPLALPHAARAAVARRT
DGEVRLHSTDVPGGVVSLRVDDLTPHSGHGWAAYPAGVVWALREAGHPVTGADIQLTSTV
PVGAGLSSSAALEVVTALALNDLFELGLTAPELAVLGQRAENDFVGVPCGVMDQMASACC
TEGHALYLDTRDLTQRQVPFDLAAHGLQLLVVDTRVKHALGDGAYAERRAGCETGARTLG
IPTLRDLPYDHLDEALGTLEAADVDESVVRYVRHVVSDNHRVERVIELLDAGDLRAAGPV
LDDGHRSLRDDLRVSCPELDLVVAAAGEAGALGARMTGGGFGGSAIVLVEDAAADTVTKA
VVEAFTSAGYAAPGIFPAVPSAGARRLSPAVPAV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaacgccgagctgaccgcctcgttcaccgagctctacggaagagcgcccgag
gggatctgggcagcacccggacgagtgaacctgatcggtgagtacaccgacttcaacgac
ggtttcgtcatgccgctggccctgccgcacgctgcgcgcgccgccgtggcccggcgcacc
gacggcgaggtgcggctgcactccaccgacgtaccgggcggagtggtctcgctccgcgtc
gacgacctcaccccgcactcgggccacggctgggccgcctacccggccggggtcgtgtgg
gcgctgcgcgaggccgggcacccggtcaccggcgcggacatccagctgacctcgaccgtc
ccggtcggcgccggactctcctcctccgccgccctcgaagtcgtcaccgccctcgcgctg
aacgacctgttcgagctgggcctcaccgccccggagctggccgtcctcggccagcgcgcc
gagaacgacttcgtcggcgtgccgtgcggggtcatggaccagatggcctcggcctgctgc
accgagggccatgcgctctacctcgacacccgcgacctcacccagcgccaggtgcccttc
gacctggccgcgcacggcctccagctcctggtcgtggacacccgggtcaagcacgccctg
ggcgacggggcgtacgcggagcggcgggccggctgcgagacgggcgcccggacactcggc
atacccaccctgcgcgacctcccgtacgaccacctggacgaggccctcggcaccctggag
gcggcggacgtcgacgagtccgtcgtgcgctacgtccgccatgtggtgagcgacaaccac
cgcgtggagcgggtcatcgagctgctcgacgcgggcgacctacgggccgccgggcccgta
ctcgacgacggacaccgctcgctccgcgacgacctgcgggtctcctgccccgagcttgac
ctggtggtcgcggcggcgggcgaggccggggcgctcggcgcccggatgaccgggggcggc
ttcggcggctccgcgatcgtcctggtggaggacgcggcggccgacacggtcaccaaggcc
gtggtggaggcgttcacctcggccgggtacgccgccccaggaatcttccccgcagtcccc
tcggccggcgcccggcggctgtctccggccgtaccagccgtttga

DBGET integrated database retrieval system