KEGG   Streptomyces sp. SirexAA-E: SACTE_2598Help
Entry
SACTE_2598        CDS       T01601                                 

Definition
(GenBank) UDP-glucose 4-epimerase
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00052  Galactose metabolism
ssx00520  Amino sugar and nucleotide sugar metabolism
ssx01100  Metabolic pathways
Module
ssx_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SACTE_2598
   00520 Amino sugar and nucleotide sugar metabolism
    SACTE_2598
Enzymes [BR:ssx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     SACTE_2598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_10 Polysacc_synt_2 NmrA NAD_binding_4 KR adh_short Pyr_redox_2 ApbA UDPG_MGDP_dh_N TrkA_N NAD_binding_7 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AEN10484
UniProt: G2NEH5
Position
complement(2931411..2932391)
Genome map
AA seq 326 aa AA seqDB search
MTNPGKKYLVTGGAGYVGSVVATHLLEAGHTVTVLDDLSTGFREGVPAGAEFIEGRVQDA
AKWLDASYDGVLHFAAFSQVGESVADPEKYWVNNVGGTTALLAAMRDAGVRTLVFSSTAA
TYGEPVSSPITETDPTAPTSPYGASKLAVDHMITGEARAHGLAAVSLRYFNVAGAYGDCG
ERHDPESHLIPLVLQVALGRRESISVYGDDYPTPDGTCVRDYIHVADLADAHLLALDAAT
PGEHLICNLGNGNGFSVREVIETVRQVTGHPVPETAAPRRDGDPAVLVASAATARERLGW
QPARADLAAIVADAWTFARREETATP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaaccccgggaagaagtacctggtgacgggcggcgcgggatacgtcggcagcgtc
gtcgccacccacctgctggaagcgggtcacaccgtgaccgtgctggacgacctctcgacc
ggcttccgcgaaggcgtgcccgccggggcggagttcatcgagggacgcgtccaggacgcc
gcgaagtggctggacgcctcctacgacggggtgctgcacttcgccgcgttctcccaggtc
ggcgagtccgtggccgacccggagaagtactgggtcaacaacgtcggcgggaccaccgcc
ctgctcgccgccatgcgcgacgccggagtgcggaccctggtcttctcgtccacggccgcg
acctacggcgagccggtctccagccccatcaccgagaccgaccccaccgcgcccaccagc
ccctacggcgcctccaagctcgccgtcgaccacatgatcaccggagaggcccgcgcccac
ggcctggccgccgtctccctgcgctacttcaacgtcgccggcgcctacggggactgcggc
gaacgccacgaccccgagtcccacctcatcccgctggtcctccaggtggcgctcggccgc
cgtgagtcgatctccgtgtacggggacgactaccccacccccgacggcacctgcgtccgc
gactacatccacgtcgccgacctcgccgacgcccacctgctggcgctggacgcggccacc
cccggcgagcacctgatctgcaacctcggcaacggcaacggcttctccgtgcgcgaggtc
atcgagaccgtccggcaggtcaccggccacccggtcccggagaccgccgccccgcgccgc
gacggcgaccccgccgtgctggtcgcctccgccgccaccgccagggaacggctcggctgg
cagccggcccgcgccgacctggccgccatcgtcgccgacgcctggacgttcgcccgccga
gaggaaaccgccacgccatga

DBGET integrated database retrieval system