KEGG   Streptomyces sp. SirexAA-E: SACTE_2610Help
Entry
SACTE_2610        CDS       T01601                                 

Definition
(GenBank) ABC transporter related protein
  KO
K15738  
ABC transport system ATP-binding/permease protein
Organism
ssx  Streptomyces sp. SirexAA-E
Brite
Transporters [BR:ssx02000]
 ABC Transporters, Eukaryotic Type
  Other subfamilies
   Other ABC transporters
    SACTE_2610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2945394..2947205)
Genome map
AA seq 603 aa AA seqDB search
MAVNLVNVEQVSKVYGTRALLDGVSLGVSEGDRIGVVGRNGDGKTTLIRMLAKLEEADTG
RVTHNGGLRLGVLTQHDSLDPKATIRHEVIGDLADHEWAGSAKIRDVLTGLFGGLALPGF
EHGLDTVIAPLSGGERRRIALAKLLIAEQDLIVLDEPTNHLDVEGISWLAGHLRNRRSAL
VCVTHDRWFLDQVCTRMWDVQRGTVHEYEGGYSDYVFARAERERIAATEESKRQNLMRKE
LAWLRRGAPARTSKPRYRIEAANELIADVPPPRDTSELMKFANARLGKTVFDLEDVTVQA
GAKTLLTHLTWQLGPGDRIGLVGVNGAGKTSLLRALAEAARSQGETQPAAGKIVVGKTVK
LAYLSQEVAELNPNIRVLEAVQQVRDRVDLGKGREMTAGQLCEQFGFSNEKQWTPVGDLS
GGERRRLQILRLLMDEPNVLFLDEPTNDLDIETLTQLEDLLDGWPGSMIVISHDRFFIER
TTDRVMALLGDRSLRMLPRGVDEYLERRKRMEEEATPASSAGTPKAAPANTVSPQAARAA
KKELQKVERQLDKMSTRETELHAQIAAHATDFEKVAGLDTELRELVAERDVLEMRWLELA
EEA
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcaatctggtcaatgtcgagcaggtcagcaaggtgtacggcacccgtgccctg
ctcgacggcgtatccctcggagtgtccgagggcgaccggatcggcgtcgtcggccgcaac
ggcgacggcaagacgacgctcatccggatgctcgccaagctggaggaggccgacaccggc
cgcgtcacccacaacggcggcctgcgcctgggcgtcctcacccagcacgactcgctcgac
ccgaaggccaccatccggcacgaggtcatcggtgacctcgccgaccacgagtgggcgggc
agcgccaagatccgcgacgtgctcaccggcctcttcggcgggctggccctgcccggcttc
gagcacggcctggacaccgtcatcgccccgctctccggcggcgagcggcgccggatcgcg
ctggcgaagctgctcatcgccgagcaggacctgatcgtcctcgacgagcccaccaaccac
ctcgacgtcgagggcatctcctggctggccgggcacctgcgcaaccggcgctccgcgctc
gtctgcgtcacccacgaccgctggttcctcgaccaggtctgcacccgcatgtgggacgtc
cagcggggcacggtccacgagtacgagggcggctacagcgactacgtcttcgcccgtgcc
gagcgcgagcggatcgccgccaccgaggagtccaagcggcagaacctgatgcgcaaggag
ctggcctggctgcggcgcggtgctcccgcccgtacgtccaagccgcgttaccgcatcgag
gcggccaacgaactcatcgccgacgtgccgccgccgcgtgacaccagcgagctgatgaag
ttcgccaacgcacggctcggcaagaccgtcttcgacctggaggacgtgaccgtccaggcc
ggtgccaagaccctgctcacccacctcacctggcagctcggccccggcgaccgcatcggt
ctggtcggcgtcaacggcgcgggcaagacctcgctgctgcgggcgctcgccgaggccgcc
cgcagccagggcgagacgcagcccgcagccgggaagatcgtggtcggcaagacggtcaag
ctggcctacctctcccaggaggtggcggagctcaacccgaacatccgcgtcctggaggcc
gtccagcaagtgcgcgaccgggtcgacctcggcaagggccgcgagatgaccgccgggcag
ctctgcgagcagttcggcttctccaacgagaagcagtggacaccggtcggggacctgtcc
ggtggcgagcggcggcggctgcagatcctgcgtctgctgatggacgagcccaacgtcctc
ttcctcgacgagcccaccaacgacctggacatcgagaccctgacccagctggaggacctc
ctcgacggctggcccggatcgatgatcgtcatctcccacgaccggttcttcatcgagcgg
accacggaccgggtgatggccctcctcggcgaccggtcgctgcggatgctgccgcgtggc
gtcgacgagtacctggagcgccggaagcgcatggaggaggaggccaccccggcctcctcc
gccgggacgccgaaggcggcacccgcgaacacggtgtcgccgcaggcggcacgggcggcg
aagaaggagctgcagaaggtcgagcggcagctcgacaagatgtcgacccgggagacggag
ctgcacgcgcagatcgccgcgcacgccaccgacttcgagaaggtggcggggctcgacacc
gagctccgcgagctggtggccgagcgcgacgtgctggagatgcgctggctggagctggcc
gaggaggcgtga

DBGET integrated database retrieval system