KEGG   Streptomyces sp. SirexAA-E: SACTE_2611Help
Entry
SACTE_2611        CDS       T01601                                 

Definition
(GenBank) hypothetical protein
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2947351..2948025
Genome map
AA seq 224 aa AA seqDB search
MRRGAGRALAGVVLAAAVLAGCSSSADEGDKGDDHGARTSSSSSSDATAKNGDRGTGRPA
VKGLTLGGPGSSCALPVTFDLAKDWKPQAVEVEPGSELAELGEQGTVTLVCEIDAKPAGN
LGYLRVWAGKEGGGDPRAALEAFVADEPNAAKAAYTETEAGSVAAVEVAYTVDGDLPGGS
KPERAFAVATPEGPVVVHLGGMDEEEHRQMLPAYELARESLKLG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgtggtgcggggcgtgccctggccggggtggtgctggcggcggcggtgctggcc
ggctgttcgtcgtcggccgacgagggtgacaagggtgacgaccacggtgcgcggacgtcc
tcgtcctcgtcctcggacgccaccgcgaagaacggcgaccgtggcacaggccgcccggcc
gtgaaggggctcacgctcggtggccccggctcgtcctgcgccctgcccgtcaccttcgac
ctggcgaaggactggaagccgcaggccgtcgaggtggagccggggtccgaactggcggag
ctgggcgagcagggcacggtgacgctggtctgcgagatcgacgccaagccggccgggaac
ctcggctatctccgtgtgtgggcgggcaaggaaggcggcggcgacccgcgtgcggcgctg
gaggcgttcgtggcggacgagccgaacgcggcgaaggccgcgtacacggagaccgaggcc
ggttccgtggccgccgtcgaggtcgcctacacggtggacggcgacctgccgggcgggtcg
aagccggagcgcgccttcgcggtcgccacccccgagggccccgtcgtggtgcacctgggc
gggatggacgaggaggaacaccggcagatgctgcccgcgtacgagctggccagggagagt
ctgaagctgggctga

DBGET integrated database retrieval system